DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and tin

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:220 Identity:54/220 - (24%)
Similarity:82/220 - (37%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   112 FVCKEDYLSNSSVAKENSLHSAT--------------TGSDPSLSPDSQDPSQDDAKDSESANVS 162
            :|.....|..:|.|:.:||.:.|              |.|:.| |..|...|.:.||..:::.|:
  Fly   209 YVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSS-SLRSIYGSDEGAKKKDNSQVT 272

Human   163 DKEA-------GSNENDDQNLGA----KRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQE 216
            ...:       ..|.|...|.|:    .:|.||......|:..|:..|......|...||.:||:
  Fly   273 SSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQK 337

Human   217 TGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGD 281
            ..|:...:::||||||.|.:| ..:...|..:|...:|    .||.   .|..|.|         
  Fly   338 LNLSATQVKIWFQNRRYKSKR-GDIDCEGIAKHLKLKS----EPLD---SPTSLPP--------- 385

Human   282 YQSEYYGPGGNYDFFPQGPPSSQAQ 306
                   |..|:..:|.....||.|
  Fly   386 -------PIPNHVMWPPTMQQSQQQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 19/83 (23%)
Homeobox 183..236 CDD:278475 18/52 (35%)
An_peroxidase_like <291..>382 CDD:265428 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 4/14 (29%)
tinNP_524433.1 HOX 301..357 CDD:197696 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.