DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and Mlp84B

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:381 Identity:71/381 - (18%)
Similarity:107/381 - (28%) Gaps:180/381 - (47%)


- Green bases have known domain annotations that are detailed below.


Human    22 RAWHVKCVQCCECKCNLTE--KCFSREGKLYCKNDFFRCFGTKCAGCAQG--------------- 69
            |:||.:|.:|..||..|..  .|.:.:..:|||..:.:.||.|..|..||               
  Fly   138 RSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCY
AKKFGPKGYGYGQGGGALQSDCYAHDDGA 202

Human    70 -------------ISPSD-------LVRRARSKV-----FHLNCFTCMMCNKQLST--------- 100
                         ..|.:       :|..|..|:     :|..||.|..|:|.|.:         
  Fly   203 PQIRAAIDVDKIQARPGEGCPRCGGVVYAAEQKLSKGREWHKKCFNCKDCHKTLDSINASDGPDR 267

Human   101 ------------GEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDA 153
                        |...|     .|.|...:|....:.::.     .:.:.|..:||:   :...|
  Fly   268 DVYCRTCYGKKWGPHGY-----GFACGSGFLQTDGLTEDQ-----ISANRPFYNPDT---TSIKA 319

Human   154 KDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETG 218
            :|.|                   |..|.|             .|.|||        .:||::.  
  Fly   320 RDGE-------------------GCPRCG-------------GAVFAA--------EQQLSKG-- 342

Human   219 LNMRVIQVWFQ---NRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPF---S 277
                  :||.:   |.....|.:..:.|...                         |:|..   :
  Fly   343 ------KVWHKKCYNCADCHRPLDSVLACDG-------------------------PDGDIHCRA 376

Human   278 FYGDYQSEYYGPGG-NYDFFPQGPPSSQAQTPVDLPFVPSSG------PSGTPLGG 326
            .||    :.:||.| .|...|              ..|.:||      |.|.||.|
  Fly   377 CYG----KLFGPKGFGYGHAP--------------TLVSTSGESTIQFPDGRPLAG 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753 12/34 (35%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 18/115 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 9/58 (16%)
Homeobox 183..236 CDD:278475 9/55 (16%)
An_peroxidase_like <291..>382 CDD:265428 11/43 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 10/40 (25%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712 12/34 (35%)
LIM_CRP_like 222..275 CDD:188712 10/52 (19%)
LIM_CRP_like 325..378 CDD:188712 15/106 (14%)
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.