DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and Six4

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster


Alignment Length:222 Identity:49/222 - (22%)
Similarity:80/222 - (36%) Gaps:50/222 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    79 ARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVC----KEDYLSNSSVAKENSLHSATTGSDP 139
            |:...|..:...| ||......|:   |.....|:|    .|.:.:|.||.:..::.:...|...
  Fly   176 AKMLQFSTDQIQC-MCEALQQKGD---IEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFH 236

Human   140 SL-------------SPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRT------ 185
            .|             ..|.|: ....|...|:..|..:..|:  .|...|..|...|:|      
  Fly   237 ELYNLLETHCFSIKYHVDLQN-LWFKAHYKEAEKVRGRPLGA--VDKYRLRKKYPLPKTIWDGEE 298

Human   186 ---TIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGAR 247
               ..|.|....||..:.....||...::.||::|||.:..:..||:|||.::            
  Fly   299 TVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRD------------ 351

Human   248 RHAFFRSPRRMRPLVDRLEPGELIPNG 274
                 |:|::...::..|..|:|..||
  Fly   352 -----RTPQQRPDIMSVLPVGQLDGNG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 13/80 (16%)
Homeobox 183..236 CDD:278475 18/61 (30%)
An_peroxidase_like <291..>382 CDD:265428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 23/115 (20%)
homeodomain 301..355 CDD:238039 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.