DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and vvl

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster


Alignment Length:299 Identity:69/299 - (23%)
Similarity:103/299 - (34%) Gaps:67/299 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   111 KFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQN 175
            |.:||...|....:.:.:|    ||||..|:                     ||.|..       
  Fly   269 KNMCKLKPLLQKWLEEAD
S----TTGSPTSI---------------------DKIAAQ------- 301

Human   176 LGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ 240
             |.||: .||:|:......|:..|...|||:......||....|...|::|||.|||.||:||..
  Fly   302 -GRKRK-KRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 364

Human   241 LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYD-------FFPQ 298
            .:.||.             .::|.:.||.:...|    |..:...:..|.|.:.       ..||
  Fly   365 PNTLGG-------------DMMDGMPPGHMHHGG----YHPHHDMHGSPMGTHSHSHSPPMLSPQ 412

Human   299 GPPSS-------QAQTPVDLPFVPSSGPSGTP--LGGLEHPLPGHHPSSEAQRFTDILAHPPGDS 354
            ...||       .|. ..::....|:..:.||  |..|...........:.|............:
  Fly   413 NMQSSAVAAHQLAAHXQSEIQESNSAAAASTPASLNSLSQQQQQQQQQQQQQHQQQQQHQQQQHT 477

Human   355 PSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNH 393
            |:...|..|...:|:::|..|..|..|.|....|:..|:
  Fly   478 PNTPSSSAGSSATMTSQVMSPQSPLGSSSAGNQANNNNN 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 14/58 (24%)
Homeobox 183..236 CDD:278475 19/52 (37%)
An_peroxidase_like <291..>382 CDD:265428 19/106 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 16/96 (17%)
vvlNP_001303384.1 POU 212..286 CDD:197673 4/16 (25%)
Homeobox 307..360 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.