DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and inv

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster


Alignment Length:189 Identity:42/189 - (22%)
Similarity:68/189 - (35%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   113 VCKEDYLSNSSVAKENSLHSA-----------------TTGSDPSLSPDSQDP------------ 148
            :|.....|||:....::.:::                 .||:......||..|            
  Fly   361 ICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRY 425

Human   149 -----------SQDDAKDSESANVSDKEAGSNENDDQNLGA---KRRGPRTTIKAKQLETLKAAF 199
                       ::...|.:.|::.:....|..|..:...|.   :.:.|||.....||..||..|
  Fly   426 SDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEF 490

Human   200 AATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMK--------QLSALGARRHA 250
            ......|...|:||:.|.|||...|::||||:|:|.::..        ||.|.|...|:
  Fly   491 NENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHS 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 13/101 (13%)
Homeobox 183..236 CDD:278475 23/52 (44%)
An_peroxidase_like <291..>382 CDD:265428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374
invNP_523699.3 Homeobox 474..527 CDD:278475 23/52 (44%)
Engrail_1_C_sig 529..554 CDD:287495 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.