DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and ap

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:288 Identity:103/288 - (35%)
Similarity:148/288 - (51%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEK--CFSREGKLYCKNDFFRCFGT-KCAG 65
            |:||.|.|.|||.|:.:::.||..|:||..|:..|..:  |:||:|.:|||||::..||| :|:.
  Fly   148 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSR 212

Human    66 CAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSL 130
            |...||.::||.|||:.|||:|||.|.:|:..|:.|::..|||. ...|:..|    |:|:|...
  Fly   213 CLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGIIDA-LIYCRTHY----SIAREGDT 272

Human   131 ----------HSATTGS--DPSLSPDSQDPSQD------------------------------DA 153
                      :||..||  :.|.||.| |||:.                              ..
  Fly   273 ASSSMSATYPYSAQFGSPHNDSSSPHS-DPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKP 336

Human   154 KDSE--SANVS------DKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIR 210
            ||.|  :||:.      |...||:.:.    .::.:..||:.|..||.|:|:.||....|.....
  Fly   337 KDIEAFTANIDLNTEYVDFGRGSHLSS----SSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDL 397

Human   211 EQLAQETGLNMRVIQVWFQNRRSKERRM 238
            :||:|:|||..||:||||||.|:|.|||
  Fly   398 KQLSQKTGLPKRVLQVWFQNARAKWRRM 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753 24/52 (46%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 21/108 (19%)
Homeobox 183..236 CDD:278475 26/52 (50%)
An_peroxidase_like <291..>382 CDD:265428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 24/52 (46%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 25/58 (43%)
Homeobox 371..424 CDD:395001 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.