DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and Lim3

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster


Alignment Length:435 Identity:155/435 - (35%)
Similarity:208/435 - (47%) Gaps:106/435 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQ 68
            |.||...|||||:|.||:|.||.||:||.||...|.:|||:|.|:|:||.|||:.:||||:.|..
  Fly   122 CGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDM 186

Human    69 GISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSA 133
            ||.|:.:||||:..|:||.||.|.||::.|:||:|.|::::.|.:||.||    ..||...|:. 
  Fly   187 GIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDY----EEAKAKGLYL- 246

Human   134 TTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAA 198
                                            .||.:.|..|   ||  |||||.||||||||.|
  Fly   247 --------------------------------DGSLDGDQPN---KR--PRTTITAKQLETLKTA 274

Human   199 FAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPR-RMRPLV 262
            :..:|||.||:||||:|:|||:|||:||||||||:||:|:|: .|...|...:|||.: ...|..
  Fly   275 YNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK-DAGRTRWSQYFRSMKGNCSPRT 338

Human   263 DR-LEPGEL-----------IPN--------------GPFSFYGDYQSEYYGPGGNYDFFPQGPP 301
            |: |:..||           :.|              .|.|..|.|......|.       |.||
  Fly   339 DKFLDKDELKVDYDSFSHHDLSNDSYSTVNLGLDEGASPHSIRGSYMHGSSSPS-------QYPP 396

Human   302 SSQAQTPVDLPFVPSSGPSG-------TPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEP 359
            ||::..||.......|.|..       ..:|...|....||....:...:|:     .:..||:.
  Fly   397 SSRSPPPVGQGHTFGSYPDNIVYTNIDQAVGSSLHASKAHHRLHSSNNVSDL-----SNDSSPDQ 456

Human   360 SLPGPLHSMSAEVFGPSP--------PFSSLSVNGGASYGNHLSH 396
            ..|.         |.|||        ..::.|.|..|:..:..||
  Fly   457 GYPD---------FPPSPDSWLGDSGSTNTTSANNNANNNSSSSH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753 29/50 (58%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 10/58 (17%)
Homeobox 183..236 CDD:278475 39/52 (75%)
An_peroxidase_like <291..>382 CDD:265428 21/105 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 17/87 (20%)
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 29/50 (58%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 25/54 (46%)
Homeobox 259..312 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.