DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX1 and CG5708

DIOPT Version :9

Sequence 1:	NP_005559.2	Gene:	LHX1 / 3975	HGNCID:	6593	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_001285799.1	Gene:	CG5708 / 34361	FlyBaseID:	FBgn0032196	Length:	241	Species:	Drosophila melanogaster

Alignment Length:	136	Identity:	50/136 - (36%)
Similarity:	67/136 - (49%)	Gaps:	22/136 - (16%)

- Green bases have known domain annotations that are detailed below.

Human     4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTE---KCFSREGKLYCKNDFFRCFGTK--C 63
            |.||...|.||:||..|||.||..|::|..|...|.|   .||:|.|.:.||.|:...||..  |
  Fly    78 CGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVC 142

Human    64 AGCAQGISPSDLVRRARSK----------------VFHLNCFTCMMCNKQLSTGEELYIIDENKF 112
            :||.:.|.||:||.:|.:.                ||||.||:|..|...|..|:. |.:.....
  Fly   143 SGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDR-YTMLGASL 206

Human   113 VCKEDY 118
            ||::|:
  Fly   207 VCEQDW 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX1	NP_005559.2	LIM1_Lhx1_Lhx5	4..55	CDD:188753	24/53 (45%)
		LIM2_Lhx1_Lhx5	63..118	CDD:188761	22/70 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	128..187
		Homeobox	183..236	CDD:278475
		An_peroxidase_like	<291..>382	CDD:265428
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	293..374
CG5708	NP_001285799.1	LIM1_LMO4	78..132	CDD:188772	24/53 (45%)
CG5708	NP_001285799.1	LIM	142..212	CDD:413332	22/70 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910