DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and Pph13

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:242 Identity:60/242 - (24%)
Similarity:82/242 - (33%) Gaps:83/242 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   172 DDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKER 236
            |...:..|:|..|||....||:.|:.||..|..|....||:||....|....:||||||||:|.|
  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66

Human   237 RMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQ------------SEYYGP 289
            :.:::..||                                  |||:            |...|.
  Fly    67 KQEKIGGLG----------------------------------GDYKEGALDLDVSYDDSAVLGQ 97

Human   290 -----GGNYDFFPQGPPSSQAQTPVDLPFVPSSG---PS---------------GTPLG--GLEH 329
                 ||.....|..||.|......:|.....:|   ||               |...|  ||..
  Fly    98 LDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSM 162

Human   330 PLPGHHPSSEAQRFTDILAHPPGDSPS------PEPSLPGPLHSMSA 370
            ....:.|.::||      .||..||.:      |:.....|:|:.|:
  Fly   163 EWSTYPPQTQAQ------THPQMDSDNQLQQHPPQQHASDPIHAGSS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 5/14 (36%)
Homeobox 183..236 CDD:278475 24/52 (46%)
An_peroxidase_like <291..>382 CDD:265428 24/106 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 23/104 (22%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 24/51 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.