DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX1 and LIMK1

DIOPT Version :9

Sequence 1:	NP_005559.2	Gene:	LHX1 / 3975	HGNCID:	6593	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_511139.2	Gene:	LIMK1 / 32207	FlyBaseID:	FBgn0283712	Length:	1257	Species:	Drosophila melanogaster

Alignment Length:	134	Identity:	40/134 - (29%)
Similarity:	59/134 - (44%)	Gaps:	2/134 - (1%)

- Green bases have known domain annotations that are detailed below.

Human     3 HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCA 67
            ||.|...|..:..::..|.:.||..|.:|..|:.:|....|.|||.|||:.|::..||..|..|.
  Fly    35 HCRGQLLPHPEEPIVMALGQQWHCDCFRCSVCEGHLHNWYFEREGLLYCREDYYGRFGDACQQCM 99

Human    68 QGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHS 132
            ..|:...:|  |....||..||.|..|...:..||...:::.:|..|.:.|...|....:.....
  Fly   100 AVITGPVMV--AGEHKFHPECFCCTACGSFIGEGESYALVERSKLYCGQCYGKRSCQPADAKARI 162

Human   133 ATTG 136
            .|.|
  Fly   163 TTAG 166

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX1	NP_005559.2	LIM1_Lhx1_Lhx5	4..55	CDD:188753	17/50 (34%)
		LIM2_Lhx1_Lhx5	63..118	CDD:188761	15/54 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	128..187		2/9 (22%)
		Homeobox	183..236	CDD:278475
		An_peroxidase_like	<291..>382	CDD:265428
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	293..374
LIMK1	NP_511139.2	LIM1_LIMK	33..88	CDD:188750	19/52 (37%)
		LIM2_LIMK	95..148	CDD:188751	15/54 (28%)
		PDZ_signaling	172..271	CDD:238492
		STKc_LIMK	407..693	CDD:271056
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910