DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and Zyx

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster


Alignment Length:151 Identity:44/151 - (29%)
Similarity:70/151 - (46%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     4 CAGCKRPIL-DRFLLNVLDRAWHVKCVQCCECKCNLTEKCF-SREGKLYCKNDFFRCFGTKCAGC 66
            |..|...:| :......:|:.:|:.|..|.:|:.||..|.| :.:||.||:.|:.:.. .||:.|
  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVC 451

Human    67 AQGISPSDLVRRARSKVFHLNCFTCMMCNKQL--------STGEELYIID-ENKF-----VCKED 117
            .:.|  .:.:.||..|.:|..||||::|.|.|        :|.:...|.| ..||     |||:.
  Fly   452 MEPI--LERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQP 514

Human   118 YLSNSS-------VAKENSLH 131
            .:.:..       ||.:.|.|
  Fly   515 IMPDPGQEETIRVVALDRSFH 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753 16/52 (31%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 22/68 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 2/4 (50%)
Homeobox 183..236 CDD:278475
An_peroxidase_like <291..>382 CDD:265428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 16/52 (31%)
LIM2_LPP 448..507 CDD:188740 19/60 (32%)
LIM3_LPP 508..575 CDD:188821 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.