DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hip14 and AT5G05070

DIOPT Version :10

Sequence 1:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_196126.2 Gene:AT5G05070 / 830389 AraportID:AT5G05070 Length:413 Species:Arabidopsis thaliana


Alignment Length:300 Identity:73/300 - (24%)
Similarity:122/300 - (40%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 GKALFDEHLMALLPLSVYLATKAWFY----VTWLMYIDDAVSFTATVCFLISSLLLWVCFLKSWK 398
            |:.:|...:.:|...|..:...|..:    :.|:...|...::|......|.:||.:...:.:..
plant    52 GRLIFGPDVSSLYLTSFLIGAPALTFCIRMLVWIKRGDPFFNYTVLASGFILTLLDFTFLMLTSA 116

  Fly   399 GDPGIIRPTREQRFKTIIELSERGGIGFEPA----------------------------SFCSGC 435
            .|||||     .|.||.:.|.:........:                            .||..|
plant   117 RDPGII-----PRNKTSMILEDDSDSSLTQSMEWVNNKTPNLKIPRTKDVFVNGYTIKVKFCDTC 176

  Fly   436 LVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGSKYYVNQ 500
            |:.||.|:.|||:|:.||.||||||||||.||..:|:.:|:.|:....::|.::........:.|
plant   177 LLYRPPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICFISSSTLLCIYVFVFSWINLIRQ 241

  Fly   501 ----CNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQVICLGMTTNERMNRG 561
                .....||.:..:..:....|  .|.:|.          |||...| ::....||.|..   
plant   242 PGKLWRTMSDDIVSVILIVYTFVA--VWFVGG----------LTIFHFY-LMSTNQTTYENF--- 290

  Fly   562 RYRHFQAKGGHSPFTRGPIQNLVDFLECSCFGLVQPKRVD 601
            |||:.:.:   :|:.||.::|:.:.|    |..:.|.::|
plant   291 RYRYDKKE---NPYKRGLLKNVKEVL----FAKIPPSQLD 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hip14NP_001261910.1 ANKYR <52..246 CDD:440430
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
ANK repeat 212..244 CDD:293786
DHHC 426..559 CDD:396215 42/164 (26%)
AT5G05070NP_196126.2 DHHC 171..292 CDD:396215 42/136 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.