| Sequence 1: | NP_001261910.1 | Gene: | Hip14 / 39747 | FlyBaseID: | FBgn0259824 | Length: | 655 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001407508.1 | Gene: | dhhc-8 / 176731 | WormBaseID: | WBGene00012718 | Length: | 475 | Species: | Caenorhabditis elegans |
| Alignment Length: | 40 | Identity: | 13/40 - (32%) |
|---|---|---|---|
| Similarity: | 19/40 - (47%) | Gaps: | 10/40 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 362 EHGNVISVTKPSNLSTLKVNINKKK-KDAFQILKPQLEAD 400 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hip14 | NP_001261910.1 | ANKYR | <52..246 | CDD:440430 | |
| ANK repeat | 77..108 | CDD:293786 | |||
| ANK repeat | 110..142 | CDD:293786 | |||
| ANK repeat | 144..175 | CDD:293786 | |||
| ANK repeat | 177..209 | CDD:293786 | |||
| ANK repeat | 212..244 | CDD:293786 | |||
| DHHC | 426..559 | CDD:396215 | |||
| dhhc-8 | NP_001407508.1 | DHHC | 98..232 | CDD:396215 | |
| Blue background indicates that the domain is not in the aligned region. | |||||