DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arl2

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_989148.1 Gene:arl2 / 394753 XenbaseID:XB-GENE-494099 Length:184 Species:Xenopus tropicalis


Alignment Length:166 Identity:80/166 - (48%)
Similarity:111/166 - (66%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILILGLDGAGKTTILYRLQVGEVVTTI-PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWR 78
            ||:|:|:||||.|||||||.:.. ||.:.|| ||:|||::.:.::..|..:||:|||.|:|.|||
 Frog    15 REVRLLMLGLDNAGKTTILKKFN-GEDINTISPTLGFNIKTLEHRGFKLNMWDVGGQKSLRSYWR 78

  Fly    79 CYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALG 143
            .|:.:||.:|:|||||||.|:.....||..:|.||.||||.|:|.|||||:.|.::...:..||.
 Frog    79 NYFESTDGLIWVVDSADRARLQDCAQELAGLLLEERLAGATLLVFANKQDLPGALSKDAIKEALE 143

  Fly   144 LENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            |:|:|...:.|...||..||.|...:|||.:.:.||
 Frog   144 LDNIKTHHWCIQGCSAVTGENLLTGIDWLLDDISSR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 76/157 (48%)
arl2NP_989148.1 Arl2 3..175 CDD:206720 78/160 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.