DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and INM1

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_011912.1 Gene:INM1 SGDID:S000001088 Length:295 Species:Saccharomyces cerevisiae

Alignment Length:234 Identity:86/235 (37%)
Similarity:126/235 (54%) Gaps:21/235 (9%)


  Fly    23 KCGPLF--LEGFQKPKTDYEVK--SAFYDLVTVYDKQIEATLTDGLLKTFPESKIIGEEAMANAK 83
            |.||:.  ..|.||   ||::|  |...|:||..|||:|..:.:.:...:|..|.||||:....:
Yeast    19 KVGPIIKSKSGTQK---DYDLKTGSRSVDIVTAIDKQVEKLIWESVKTQYPTFKFIGEESYVKGE 80

  Fly    84 TPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYSAWQGHGAYL 148
            |  .:||.||:||||||||.|:|...|..|.|:||.:|||.|:|::|||..|.|.||.:|:|..:
Yeast    81 T--VITDDPTFIIDPIDGTTNFVHDFPFSCTSLGLTVNKEPVVGVIYNPHINLLVSASKGNGMRV 143

  Fly   149 NGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLY-------KLASS----ATGTRSFGCA 202
            |.:..:..:..:...:|:..: |::.:..|..:..|...       ||.|.    ..|.|:.|.:
Yeast   144 NNKDYDYKSKLESMGSLILNK-SVVALQPGSAREGKNFQTKMATYEKLLSCDYGFVHGFRNLGSS 207

  Fly   203 ALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRV 241
            |:|:.|||.|..|:|.......||:..|..||:|.||||
Yeast   208 AMTMAYIAMGYLDSYWDGGCYSWDVCAGWCILKEVGGRV 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 86/235 (37%)
INM1NP_011912.1 IMPase 10..267 CDD:238817 86/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0483
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I1007
Isobase 1 0.950 0 Normalized mean entropy S3073
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 1 1.000 T133839
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 1 0.910 0.893 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.