DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and impa2

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001018408.1 Gene:impa2 ZFINID:ZDB-GENE-050522-349 Length:275 Species:Danio rerio

Alignment Length:268 Identity:102/269 (38%)
Similarity:153/269 (57%) Gaps:7/269 (3%)


  Fly    16 VSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIGEEAMA 80
            |::::.|:.|.:.....|..|. ...||...||||..|.|:|..:...|.:.:|..:.||||:.|
Zfish    10 VAVDIARRAGQMVSCAVQLEKR-VSSKSTPTDLVTEADHQVEELIISTLREKYPTHRFIGEESSA 73

  Fly    81 NAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYSAWQGHG 145
             |....||||:|||||||||||.|:|...|...:|:|.|:.|||..|::|:.....||:|.:|||
Zfish    74 -AGVKCELTDSPTWIIDPIDGTCNFVHSFPMVAVSIGFAVRKELEFGVIYHCFDGTLYTARKGHG 137

  Fly   146 AYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSAT-GTRSFGCAALTLCYI 209
            |:.||..::||..|.:::||:..||.....|...|..:..:.|:.|:.| |.|..|.:.|:||.:
Zfish   138 AFCNGVRLQVSKEKDVSKALILTEIGAKRDSATLDIFLGNMKKILSAPTHGVRIIGSSTLSLCQV 202

  Fly   210 AAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEELAKSVIQLIE- 273
            |:|..:||:...|..||:|..|||:|||||.|..|:|...|:|....|...:.|:|:.|::.:: 
Zfish   203 ASGAAEAYYQYGLHCWDIAAAAVIIREAGGCVMDTTGGPLDLMSRRVVAAGTREIAEYVVKQLQP 267

  Fly   274 ---GADQI 278
               |.|.:
Zfish   268 INYGRDDL 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 97/245 (40%)
impa2NP_001018408.1 IMPase 7..252 CDD:238817 97/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110097358
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.