DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and impa1

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis

Alignment Length:278 Identity:97/279 (35%)
Similarity:156/279 (56%) Gaps:24/279 (9%)


  Fly    10 LEVYYQVSLE----LVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPE 70
            :|..:|.|::    :.||.|.:..... |......|||:..||||..|:::|..|...:.:.:|.
 Frog     1 MEDQWQESMDFAILIARKAGSVVCAAL-KEDVSIMVKSSPADLVTATDQKVEEMLISSIKEKYPS 64

  Fly    71 SKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSAN 135
            ...||||::| |.....|||.|||||||||||.|:|.:.|...:|:|.|:||::..|:||:...:
 Frog    65 HSFIGEESVA-AGAGSTLTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFGVVYSCVED 128

  Fly   136 ELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEIS--------LIVVSKGRDKNVKRLYKLASS 192
            ::|:..:|.||:.|||.::||..|.|.::::..|:.        .:|:|     |::||  |...
 Frog   129 KMYTGRKGKGAFCNGQKLQVSGQKDITKSMIITELGSNRNPEVIKMVLS-----NMERL--LCIP 186

  Fly   193 ATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCV 257
            ..|.|:.|.||:.:|.:|.|..|||:...:..||:|..:||:.||||.|...:|..||:|....:
 Frog   187 IHGIRAVGTAAVNMCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAFDLMSCRVI 251

  Fly   258 CTSSEELAKSV---IQLI 272
            ..||.::|:.:   :|:|
 Frog   252 AASSRDIAERIAKELQII 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 91/259 (35%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110070133
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.