DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and CG17029

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001261908.1 Gene:CG17029 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster

Alignment Length:284 Identity:197/285 (69%)
Similarity:234/285 (82%) Gaps:0/285 (0%)


  Fly     1 MSYRIGEEKLEVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLL 65
            ||..:.|.||:.||.|:|:||.|||||..||:||.||:|:||:.|||||||||||||..||:||:
  Fly     1 MSSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVTVYDKQIEDILTEGLV 65

  Fly    66 KTFPESKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVY 130
            ..||||.|||||..|.::...||||||||||||||||.|::.:|||||||||||||||||:||:|
  Fly    66 AAFPESLIIGEEESAVSQRQAELTDAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGIIY 130

  Fly   131 NPSANELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATG 195
            ||.||||:||::||||||||:||..|....|.||::.||||||..:..||||||||||:||:|||
  Fly   131 NPPANELFSAYKGHGAYLNGEPIHTSKVTTIKQAVIAYEISLIHAAGVRDKNVKRLYKMASNATG 195

  Fly   196 TRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTS 260
            ||.||.|||||||:|.|:|||||||:|||||:|.||:||.||||.|.||||::||||||||||.:
  Fly   196 TRCFGSAALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAGGTVCHTSGSKFDVMKPDCVCAA 260

  Fly   261 SEELAKSVIQLIEGADQISGYTFK 284
            :.||||:||.|||.|.||:.||||
  Fly   261 TPELAKNVISLIEEAGQITEYTFK 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 176/247 (71%)
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 176/248 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139745474
eggNOG 1 0.900 E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I1007
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000888
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 P PTHR20854
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.