DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and IMPA2

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_055029.1 Gene:IMPA2 HGNCID:6051 Length:288 Species:Homo sapiens

Alignment Length:272 Identity:101/273 (37%)
Similarity:149/273 (55%) Gaps:19/273 (7%)


  Fly    11 EVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIG 75
            |..:|.:::|..:.|.:..:...:.|. ...|::..||||..|..:|..:...|.:.||..:.|.
Human    17 EECFQAAVQLALRAGQIIRKALTEEKR-VSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIA 80

  Fly    76 EEAMAN-AKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYS 139
            |||.|: ||.  .||.:|||||||||||.|:|.:.|...:|:|.|:.:||..|::|:.:...||:
Human    81 EEAAASGAKC--VLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYT 143

  Fly   140 AWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRD--------KNVKRLYKLASSATGT 196
            ..:|.||:.|||.:.||....:::|||..||     ...||        .|::||  |.:.|.|.
Human   144 GRRGRGAFCNGQRLRVSGETDLSKALVLTEI-----GPKRDPATLKLFLSNMERL--LHAKAHGV 201

  Fly   197 RSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSS 261
            |..|.:.|.||::|:|..|||:...|..||||...||:|||||.|..|||...|:|....|..|:
Human   202 RVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAAST 266

  Fly   262 EELAKSVIQLIE 273
            .|:|..:.|.::
Human   267 REMAMLIAQALQ 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 96/256 (38%)
IMPA2NP_055029.1 IMPase 19..265 CDD:238817 96/256 (38%)
Substrate binding 103..106 3/3 (100%)
Substrate binding 205..207 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110107678
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.