DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and IMPA1

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 / 3612 HGNCID:6050 Length:336 Species:Homo sapiens


Alignment Length:291 Identity:97/291 - (33%)
Similarity:162/291 - (55%) Gaps:29/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YRIGEEKLEV-YYQ-----------VSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQ 55
            |..|:.|:.| |:|           .::.|.|:.|.:..|.. |.:.:..:||:..||||..|::
Human    45 YGFGKMKIFVKYFQKMADPWQECMDYAVTLARQAGEVVCEAI-KNEMNVMLKSSPVDLVTATDQK 108

  Fly    56 IEATLTDGLLKTFPESKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAI 120
            :|..|...:.:.:|....||||::| |.....|||.|||||||||||.|:|.:.|...:|:|.|:
Human   109 VEKMLISSIKEKYPSHSFIGEESVA-AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAV 172

  Fly   121 NKELVLGIVYNPSANELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEIS--------LIVVSK 177
            ||::..|:||:....::|:|.:|.||:.|||.::||..:.|.::|:..|:.        .:|:| 
Human   173 NKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLS- 236

  Fly   178 GRDKNVKRLYKLASSATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVY 242
                |:::|:.:  ...|.||.|.||:.:|.:|.|..|||:...:..||:||..:|:.||||.:.
Human   237 ----NMEKLFCI--PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLM 295

  Fly   243 HTSGARFDVMKPDCVCTSSEELAKSVIQLIE 273
            ..:|..||:|....:..::..||:.:.:.|:
Human   296 DVTGGPFDLMSRRVIAANNRILAERIAKEIQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 90/265 (34%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 88/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.