DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and IMPA1

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 HGNCID:6050 Length:336 Species:Homo sapiens

Alignment Length:293 Identity:99/294 (34%)
Similarity:163/294 (55%) Gaps:32/294 (11%)


  Fly     3 YRIGEEKLEV-YYQ-----------VSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQ 55
            |..|:.|:.| |:|           .::.|.|:.|.:..|.. |.:.:..:||:..||||..|::
Human    45 YGFGKMKIFVKYFQKMADPWQECMDYAVTLARQAGEVVCEAI-KNEMNVMLKSSPVDLVTATDQK 108

  Fly    56 IEATLTDGLLKTFPESKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAI 120
            :|..|...:.:.:|....||||::| |.....|||.|||||||||||.|:|.:.|...:|:|.|:
Human   109 VEKMLISSIKEKYPSHSFIGEESVA-AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAV 172

  Fly   121 NKELVLGIVYNPSANELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEIS--------LIVVSK 177
            ||::..|:||:....::|:|.:|.||:.|||.::||..:.|.::|:..|:.        .:|:| 
Human   173 NKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLS- 236

  Fly   178 GRDKNVKRLYKLASSATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVY 242
                |:::|:.:  ...|.||.|.||:.:|.:|.|..|||:...:..||:||..:|:.||||.:.
Human   237 ----NMEKLFCI--PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLM 295

  Fly   243 HTSGARFDVMKPDCVCTSSEELAKSV---IQLI 272
            ..:|..||:|....:..::..||:.:   ||:|
Human   296 DVTGGPFDLMSRRVIAANNRILAERIAKEIQVI 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 90/266 (34%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 88/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110074464
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.