DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and ttx-7

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001122453.2 Gene:ttx-7 WormBaseID:WBGene00008765 Length:285 Species:Caenorhabditis elegans

Alignment Length:280 Identity:107/281 (38%)
Similarity:159/281 (57%) Gaps:18/281 (6%)


  Fly     8 EKLEVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESK 72
            |:.:|:...::|||:|.|.|....|..|::..:.||:..||||..|:.:|..|.:||.:.|...:
 Worm     8 EEEQVFVDYAIELVKKAGTLVRTAFDSPESKVDTKSSNTDLVTETDQAVEKLLIEGLSERFKGHR 72

  Fly    73 IIGEEAMA-NAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANE 136
            .||||::| .||.  |.||||||||||||||.|:|.:||...|.|||||.|::..||||||..||
 Worm    73 FIGEESVAGGAKI--EWTDAPTWIIDPIDGTTNFVHRIPMIAICVGLAIKKQIRAGIVYNPITNE 135

  Fly   137 LYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEISL----------IVVSKGRDKNVKRLYKLAS 191
            ||.|..|.||:.||.||..|..:.:::.::|..:.|          :.:::...:|     ::.:
 Worm   136 LYLAQLGKGAFKNGFPIRASKNQLLSKGVLCQSLGLHNRVQFGDRWLDIAQSNMRN-----QVMA 195

  Fly   192 SATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDC 256
            ...|.||||.||:.:..:|.|.||.|....:..||:|..::|:.||||.|...:|:.||||....
 Worm   196 GVRGHRSFGSAAINMVMVAQGSCDGYVEYGIHAWDVAAPSIIVTEAGGVVTDPTGSPFDVMSRKV 260

  Fly   257 VCTSSEELAKSVIQLIEGAD 276
            :|..:.||.:.:...:...|
 Worm   261 LCAGTAELGRDLSACLTHVD 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 102/258 (40%)
ttx-7NP_001122453.2 IMPase 13..263 CDD:238817 102/257 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.