DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and Impa2

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_444491.1 Gene:Impa2 / 114663 MGIID:2149728 Length:290 Species:Mus musculus


Alignment Length:269 Identity:100/269 - (37%)
Similarity:150/269 - (55%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIGEEA 78
            ::|:::|..:.|.:..:...:.|. ...|::..||||..|.::|..:...|.|.||..:.|.|||
Mouse    22 FEVAVQLALRAGQIIRKALTEEKR-VSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEA 85

  Fly    79 MAN-AKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYSAWQ 142
            .|: ||.  .||.:|||||||||||.|:|.:.|...:|:|.|:::||..|::::.:...||:..:
Mouse    86 TASGAKC--VLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLYTGRR 148

  Fly   143 GHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRD--------KNVKRLYKLASSATGTRSF 199
            |.||:.|||.::||....:.:|||..||     ...||        .|::||  |.:.|.|.|..
Mouse   149 GQGAFCNGQRLQVSRETDLAKALVLTEI-----GPKRDPDTLKVFLSNMERL--LHAKAHGVRVI 206

  Fly   200 GCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEEL 264
            |.:.|.|||:|:|..|||:...|..||||...||:|||||.|..|||...|:|....|...:.|:
Mouse   207 GSSTLALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTREM 271

  Fly   265 AKSVIQLIE 273
            |..:.|.::
Mouse   272 AVLIAQALQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 97/254 (38%)
Impa2NP_444491.1 IMPase 21..266 CDD:238817 97/253 (38%)
Substrate binding. /evidence=ECO:0000250 105..108 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 207..209 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.