DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and Impa2

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_444491.1 Gene:Impa2 MGIID:2149728 Length:290 Species:Mus musculus

Alignment Length:269 Identity:100/270 (37%)
Similarity:150/270 (56%) Gaps:19/270 (7%)


  Fly    14 YQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIGEEA 78
            ::|:::|..:.|.:..:...:.|. ...|::..||||..|.::|..:...|.|.||..:.|.|||
Mouse    22 FEVAVQLALRAGQIIRKALTEEKR-VSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEA 85

  Fly    79 MAN-AKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYSAWQ 142
            .|: ||.  .||.:|||||||||||.|:|.:.|...:|:|.|:::||..|::::.:...||:..:
Mouse    86 TASGAKC--VLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLYTGRR 148

  Fly   143 GHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRD--------KNVKRLYKLASSATGTRSF 199
            |.||:.|||.::||....:.:|||..||     ...||        .|::||  |.:.|.|.|..
Mouse   149 GQGAFCNGQRLQVSRETDLAKALVLTEI-----GPKRDPDTLKVFLSNMERL--LHAKAHGVRVI 206

  Fly   200 GCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEEL 264
            |.:.|.|||:|:|..|||:...|..||||...||:|||||.|..|||...|:|....|...:.|:
Mouse   207 GSSTLALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTREM 271

  Fly   265 AKSVIQLIE 273
            |..:.|.::
Mouse   272 AVLIAQALQ 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 97/255 (38%)
Impa2NP_444491.1 IMPase 21..266 CDD:238817 97/254 (38%)
Substrate binding. {ECO:0000250} 105..108 3/3 (100%)
Substrate binding. {ECO:0000250} 207..209 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110107199
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.