DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17028 and NEWGENE_1306455

Sequence 1:NP_001189114.1 Gene:CG17028 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_008761786.1 Gene:NEWGENE_1306455 RGDID:9185928 Length:356 Species:Rattus norvegicus

Alignment Length:267 Identity:65/268 (24%)
Similarity:111/268 (41%) Gaps:71/268 (26%)


  Fly    36 KTDYEVKSAFYDLVTVYDKQIEATLTDGLL--KTFPESKIIGEEAMANAKTPPELTDAPTWIIDP 98
            |..|.:|:||.::....::.::|:..:.::  :..||.  |.:|..|..:.|.|  ....| |||
  Rat   114 KMFYLLKTAFPNVQINTEEHVDASDKEVIVWNRKIPED--ILKEIAAPKEVPAE--SVTVW-IDP 173

  Fly    99 IDGTNNYVRKI-PHCCISVGLAINKELVLGIVYNPSANELYSAWQGHGAYLNGQPIEVSNAK--- 159
            :|.|..|...: .:....|.:|:|.:.|||:::.|.:.  |:||    |.::..    ||.|   
  Rat   174 LDATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSE--YTAW----AMVDSG----SNVKARS 228

  Fly   160 KINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRSFGCAALTLCYIAAG------------ 212
            ..|:     :...|:||:.....||::        ..::||...|.:....||            
  Rat   229 SYNE-----KTPKIIVSRSHAGMVKQV--------ALQTFGNQTLIIPAGGAGYKVLALLDVPDM 280

  Fly   213 ---RCDAY-HVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEELAKSVIQLIE 273
               :.|.| ||..:|.||:..|..||:..||.:...||               ||::.:      
  Rat   281 TQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSG---------------EEISYT------ 324

  Fly   274 GADQISG 280
            |:|.|.|
  Rat   325 GSDGIEG 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 59/246 (24%)
NEWGENE_1306455XP_008761786.1 IPPase 64..347 CDD:238818 65/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110161704
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.