DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17026 and Impa1

Sequence 1:NP_648820.1 Gene:CG17026 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006530140.1 Gene:Impa1 MGIID:1933158 Length:330 Species:Mus musculus

Alignment Length:277 Identity:96/278 (35%)
Similarity:159/278 (57%) Gaps:13/278 (5%)


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            :|..|:...||.:|||::.|..:|. ..|.:|... .::||..|.::|:.|:..|..:||.|.||
Mouse    59 QECMDYAVILARQAGEMIREALKNE-MDVMIKSSP-ADLVTVTDQKVEKMLMSSIKEKYPCHSFI 121

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            |||.....:...  .|:.|||:|||||||:||:.:.|.|:||||..:.|::..|:|.:..::|:|
Mouse   122 GEESVAAGEKTV--FTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMY 184

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAP---KIRNKHIKRIYHVGSNARRLLAYS 200
            |.:.|:||||||:.:|||..|.:..:.:..|:.....|   :|...:::::..:..:..|.:..:
Mouse   185 TGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTA 249

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETL- 264
            ||  ::|:||.|..||::...::.||.|...:::.|||||:....|||||:|...:|.|.:.|| 
Mouse   250 AV--NMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLA 312

  Fly   265 ---RAEIEHLIRKADQE 278
               ..|||.:..:.|.|
Mouse   313 KRIAKEIEIIPLQRDDE 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 87/251 (35%)
Impa1XP_006530140.1 IMPase 61..307 CDD:238817 88/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110072007
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.