DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17026 and impad1

Sequence 1:NP_648820.1 Gene:CG17026 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001016215.2 Gene:impad1 XenbaseID:XB-GENE-5751033 Length:356 Species:Xenopus tropicalis

Alignment Length:253 Identity:51/254 (20%)
Similarity:98/254 (39%) Gaps:57/254 (22%)


  Fly    50 AYDNQIEEFLVEKILARYPDHKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQ-IPHVS 113
            ::|..|.:.:.|:|                |..:|..|   :.|..|||:|.|..:.:. :.:|:
 Frog   139 SWDRNIPDDIKEQI----------------KTKHVASE---SITMWIDPLDATQEYTENLVNYVT 184

  Fly   114 VSIGLSIKKQIVLGVVNNPAQNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKI 178
            ..:.:::..:.|:||::.|.......|.|..|:       .:......|:....:.|...|:.::
 Frog   185 TMVCVAVNGKPVIGVIHKPFTGFTAWAMLDGGS-------SIKKRNSYNEKTPTFIVSRSHSGEV 242

  Fly   179 R--------NKHIKRIYHVGSNARRLLAYSAVVDSLCMVAAGNLDAF-HIEDMYPWDCAAGYLLI 234
            :        ||  ..|...|....::|:...|.|.....|    |.: |:..:..||..||..::
 Frog   243 KEVTRQTFGNK--TEIISAGGAGYKVLSLLDVTDDKQETA----DVYIHVTYIKKWDICAGNAIL 301

  Fly   235 REAGGVVTHPYGGPFDIMKPDLICAGTET----LRAEI--EH--LIRKADQEKHVGGE 284
            ...||.:|...|       .:::..|:|.    |.|.|  :|  |:.|..::..|..:
 Frog   302 NALGGQMTTLKG-------EEIMYTGSELNKGGLLASIGMDHGVLVEKLAEKLQVNAK 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 42/219 (19%)
impad1NP_001016215.2 IPPase 56..342 CDD:238818 49/242 (20%)
Substrate binding. {ECO:0000250} 169..172 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110160348
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.