DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17026 and CG17027

Sequence 1:NP_648820.1 Gene:CG17026 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001261909.1 Gene:CG17027 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster

Alignment Length:281 Identity:218/282 (77%)
Similarity:251/282 (89%) Gaps:1/282 (0%)


  Fly     4 SKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYP 68
            |::.|||||:||:|||::|||||:|||:.|.|.|::| |:||:|||.|||:||:||:||||||||
  Fly     5 SQADIEELYNFIHPLAIKAGEILMEGYEMASKNVSIK-GDFYDVVTDYDNKIEDFLMEKILARYP 68

  Fly    69 DHKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPA 133
            ||||||||:|.||:||:.|||:||||||||||||||||||||||.|||||:|.||||:||:|||.
  Fly    69 DHKFIGEEETAKNNNVSGELTNAPTWIIDPIDGTSNFIKQIPHVCVSIGLAINKQIVVGVINNPV 133

  Fly   134 QNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLA 198
            |.||:|.|||||||||||||.|||||.:.||||||||.|||...:.|||||||||||.|||||:|
  Fly   134 QKKLFTTKLGQGAFCNGKPIHVSSCESVKDANVAYEVSLLHVHSVANKHIKRIYHVGLNARRLVA 198

  Fly   199 YSAVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTET 263
            ||.|||.||||||||||||:||||||||||||.||::|||||||||:|||||||||||||||||.
  Fly   199 YSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAGTEK 263

  Fly   264 LRAEIEHLIRKADQEKHVGGE 284
            ||.|||.|:||.|||:.|||:
  Fly   264 LRKEIEDLLRKGDQEESVGGK 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 196/248 (79%)
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 196/248 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139745465
eggNOG 1 0.900 E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2039
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 P PTHR20854
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.