DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17026 and Impa2

Sequence 1:NP_648820.1 Gene:CG17026 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_444491.1 Gene:Impa2 MGIID:2149728 Length:290 Species:Mus musculus

Alignment Length:277 Identity:101/278 (36%)
Similarity:164/278 (59%) Gaps:13/278 (5%)


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            :|.::....||:|||:|:.:..... |.|:.|... .::||..|:::|:.:|.::..|:|.|:||
Mouse    19 DECFEVAVQLALRAGQIIRKALTEE-KRVSTKTSA-ADLVTETDHRVEDLIVSELRKRFPSHRFI 81

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            .||.|.......  ||.:|||||||||||.||:.:.|.|:||||.::.:::..||:::..:.:||
Mouse    82 AEEATASGAKCV--LTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLY 144

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAP---KIRNKHIKRIYHVGSNARRLLAYS 200
            |.:.||||||||:.:|||....|..|.|..|:.....|   |:...:::|:.|..::..|::..|
Mouse   145 TGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSS 209

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETLR 265
            .:  :||.:|:|..||::...::.||.||..::||||||:|....|||.|:|...::.|||.   
Mouse   210 TL--ALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTR--- 269

  Fly   266 AEIEHLIRKADQEKHVG 282
             |:..||.:|.|..:.|
Mouse   270 -EMAVLIAQALQTINYG 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 91/251 (36%)
Impa2NP_444491.1 IMPase 21..266 CDD:238817 91/251 (36%)
Substrate binding. {ECO:0000250} 105..108 3/3 (100%)
Substrate binding. {ECO:0000250} 207..209 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110107260
eggNOG 1 0.900 E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1598
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406919at33208
OrthoFinder 1 1.000 FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126810
Panther 1 1.100 O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.