DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pka-C3 and AT2G20050

Sequence 1:NP_730083.2 Gene:Pka-C3 FlyBaseID:FBgn0000489 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_179595.5 Gene:AT2G20050 AraportID:AT2G20050 Length:1094 Species:Arabidopsis thaliana

Alignment Length:422 Identity:120/423 (28%)
Similarity:204/423 (48%) Gaps:38/423 (9%)


  Fly   189 SSSTATTTTTSSADHDNDVDEEDEEDDENEGE--------GNGRDADDA-----------THDSS 234
            |.:.::.||..:.::||.....:...:::||.        |..:|:...           |.::.
plant   673 SQNVSSLTTGITNEYDNLEIGTEVSIEKHEGSYFGEWALLGELKDSLSVVAVGEVVCVVLTKENF 737

  Fly   235 ESIE------EDDGNETDDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRD 293
            ||..      .|||.:| .....:.|:||:.|.....:.|..|.|.:....:.|.....:.|...
plant   738 ESAVGPLTNISDDGPKT-RHSSFELSKESAKVTDTTALAKATLADLEWTTCLSTTDCSEIGLVHL 801

  Fly   294 RISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLE--WSTKDDSNLYMIFDYVCG 356
            :..|...::|..:..:|.:|.:...|..|||:::.:..|..|..|  .:..|.:...::.:....
plant   802 KDKENLLSLKRFSKQKVKKLGKEAQVLKERNLMKNVIKPSAIVPEILCTCVDQTFAAILLNTTLA 866

  Fly   357 GELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKK 421
            ..:.:.|.:  .....:..|....:|||:|.:|..:|::|...||.|::::.|:|:|.||.||||
plant   867 CPISSLLHS--PLDESSVRFITGSLVSAIEDIHKNEILFRGSSPELLMLDQSGYLQIVDFRFAKK 929

  Fly   422 LR-DRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPF--YDEQPFGIYEKILS 483
            |. :||:|:||..:|:||||:|.|||..|.||||||||||.||.|..||  :.|.....::||..
plant   930 LSGERTFTICGNADYLAPEIVQGKGHGYAADWWALGVLIYYMLEGEMPFGSWRESELDTFQKIAK 994

  Fly   484 GKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPP--IL 546
            |::.:.|.:...|:|||.|||..|...|.|: :.|.:.:|:|.||..|.|..:.:::.:.|  |:
plant   995 GQLTFPRVLSSEAEDLITKLLEVDENLRFGS-QGGPESIKKHPWFNGLKWEAISNREFQVPQEII 1058

  Fly   547 PDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQ 578
            ..:||..:..|.  .|.:..|.....:.:|.|
plant  1059 SRIHHHLENDNV--LPLETSKSLDTTEDQDAQ 1088

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pka-C3NP_730083.2 PTZ00263 262..583 CDD:140289 100/325 (31%)
STKc_PRKX_like 272..563 CDD:270763 95/298 (32%)
AT2G20050NP_179595.5 PP2Cc 123..397 CDD:238083
Crp 485..>625 CDD:223736
CAP_ED 491..600 CDD:237999
CAP_ED 617..>714 CDD:237999 8/41 (20%)
PKc_like 797..1054 CDD:304357 87/260 (33%)
Pkinase 798..1038 CDD:278497 84/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24353
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.