DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and AT5G16470

DIOPT Version :10

Sequence 1:NP_648808.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_197151.1 Gene:AT5G16470 / 831508 AraportID:AT5G16470 Length:104 Species:Arabidopsis thaliana


Alignment Length:83 Identity:26/83 - (31%)
Similarity:34/83 - (40%) Gaps:27/83 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QAKLKKQQGHSANDQKKAAQKALV----------------------YVCAVCKSQMPDPKTYKQH 60
            :||.||   |:|.:.:..|..||.                      |.|..||..:||.||.:.|
plant     4 KAKPKK---HTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLKTMQIH 65

  Fly    61 FENKHPK--NDIPEELKE 76
            .|:||||  .:.|..|.|
plant    66 HESKHPKLTYEEPRNLHE 83

Return to query results.
Submit another query.