DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and znf706.2

DIOPT Version :8

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001016744.1 Gene:znf706.2 / 549498 XenbaseID:XB-GENE-5725709 Length:75 Species:Xenopus tropicalis

Alignment Length:77 Identity:47/78 (60%)
Similarity:60/78 (77%) Gaps:4/78 (5%)


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            ||||.||||:|.|.::|||:.||.    .||||.||:.|||:.|.||::|||||||:|||||:||
 Frog     1 MARGQQKIQAQQKNAKKQAEKKKH----GNDQKAAAKAALVFTCPVCRTQMPDPKTFKQHFESKH 61

  Fly    66 PKNDIPEELKEV 77
            ||:.:|.||.:|
 Frog    62 PKSPMPPELADV 73

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15715NP_001246778.1 None
znf706.2NP_001016744.1 4F5 1..36 CDD:282298 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234190564
eggNOG 1 0.900 E1_KOG4118
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4664
OMA 1 1.010
OrthoDB 1 1.010 D1620202at2759
OrthoFinder 1 1.000 FOG0002821
OrthoInspector 1 1.000 T129324
Phylome 1 0.910 0.933 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.770

Return to query results.
Submit another query.