DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and Zfp706

DIOPT Version :8

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001119559.1 Gene:Zfp706 / 500855 RGDID:1563959 Length:54 Species:Rattus norvegicus

Alignment Length:55 Identity:33/56 (59%)
Similarity:41/56 (73%) Gaps:3/56 (5%)


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPK 55
            ||||.||||||.|.::|||..||:|||   |||.||:.||:|.|.||:.::|.||
  Rat     1 MARGQQKIQSQQKNAKKQAGQKKKQGH---DQKAAAKAALIYTCTVCRVRVPRPK 52



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5182
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002821
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.950 Consistency score
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.