DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and znf706

DIOPT Version :8

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001185818.1 Gene:znf706 / 402905 ZFINID:ZDB-GENE-040718-454 Length:76 Species:Danio rerio

Alignment Length:77 Identity:52/78 (67%)
Similarity:65/78 (83%) Gaps:3/78 (4%)


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            |||||||||||.|.::|||::||.:||   |||.||:.|||:.||||:||||||||:|||||:||
Zfish     1 MARGHQKIQSQQKNAKKQAEIKKSKGH---DQKTAAKAALVFTCAVCRSQMPDPKTFKQHFESKH 62

  Fly    66 PKNDIPEELKEV 77
            ||:.:|.||:.|
Zfish    63 PKSPLPPELEGV 74

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15715NP_001246778.1 None
znf706NP_001185818.1 4F5 1..37 CDD:282298 25/39 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234185282
eggNOG 1 0.900 E1_KOG4118
Hieranoid 1 1.000
Homologene 1 1.000 H128235
Inparanoid 1 1.050 111 1.000 Inparanoid score I4778
OMA 1 1.010
OrthoDB 1 1.010 D1620202at2759
OrthoFinder 1 1.000 FOG0002821
OrthoInspector 1 1.000 T597790
orthoMCL 1 0.900 OOG5_132073
Panther 1 1.100 LDO PTHR21213
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.