DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and GALNT4

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_003765.2 Gene:GALNT4 HGNCID:4126 Length:578 Species:Homo sapiens

Alignment Length:545 Identity:173/546 (32%)
Similarity:247/546 (45%) Gaps:116/546 (21%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPH 65
            :.|.:|...:...|:|..|.:||:||.|.|.:||.|..:|....::.....|.|::||...|...
Human    85 LNEDELKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQKFNYRTLPTTSVIIAFYNEAWS 149

  Fly    66 TLLRGIYSVITQTSP-YLLKEIVLVHDGHPDLDLIRHIHHKLPIVIQLEMESS------------ 117
            ||||.|:||: :||| .|||||:||.|          :..::.:..|||...|            
Human   150 TLLRTIHSVL-ETSPAVLLKEIILVDD----------LSDRVYLKTQLETYISNLDRVRLIRTNK 203

  Fly   118 -KGIIHARLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFA-YR 180
             :|::.|||.||..||||:|.||:.|.|...|||.||||.|..:...|..|::|.|...:|. |.
Human   204 REGLVRARLIGATFATGDVLTFLDCHCECNSGWLEPLLERIGRDETAVVCPVIDTIDWNTFEFYM 268

  Fly   181 KLVEPEQLAFDWQLDHIFLPLDQHSWNSLPK-----------PYPSSQLEGRVFAIDRKWFWHLG 234
            ::.||....|||:|        ...|:|:||           |..|..:.|.:||:.:|:|.:||
Human   269 QIGEPMIGGFDWRL--------TFQWHSVPKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLG 325

  Fly   235 GWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPSLQVQKNFKRV 299
            .:|.|:..:||:.||||.:||||||.:...|||.||.::.:      .||...|:.  .:|..|.
Human   326 TYDTGMEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPK------RAPYARPNF--LQNTARA 382

  Fly   300 VDVWLDEYKLHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQ------------- 351
            .:||:||||.|||..||..|......:.:.:.||.||.||||:||...|.|.             
Human   383 AEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFPNLHVPEDRPGWHGA 447

  Fly   352 IRNHFLHAGLTNY------PIGKIMPFVAPHFCLSIKGGFPVIRKCHSTN----FEDWTLTSRCQ 406
            ||:..:.:...:|      |.|.         .||:.|       ||...    ||   .||..:
Human   448 IRSRGISSECLDYNSPDNNPTGA---------NLSLFG-------CHGQGGNQFFE---YTSNKE 493

  Fly   407 LKHGN---MCLDV-DYKNNVRATKCTKKLSKNP----WHYNYQHSSFVSNGNKCLQI-------- 455
            ::..:   :|.:| :.||.|....|.|.....|    ||:....:.|..:...||..        
Human   494 IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRP 558

  Fly   456 DVNKVGLILSACDSDVTEQRWMFTK 480
            ||.     :..||:....|.|.|.|
Human   559 DVQ-----MRTCDALDKNQIWSFEK 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 114/310 (37%)
pp-GalNAc-T 54..349 CDD:133004 121/321 (38%)
RICIN 367..478 CDD:238092 29/131 (22%)
Ricin_B_lectin 373..476 CDD:279046 27/123 (22%)
GALNT4NP_003765.2 Catalytic subdomain A 134..243 49/120 (41%)
pp-GalNAc-T 138..432 CDD:133004 121/321 (38%)
Catalytic subdomain B 303..365 28/62 (45%)
Ricin_B_lectin 446..574 CDD:306998 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.