DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt16

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_001339749.3 Gene:galnt16 ZFINID:ZDB-GENE-131120-189 Length:567 Species:Danio rerio

Alignment Length:491 Identity:143/492 (29%)
Similarity:235/492 (48%) Gaps:62/492 (13%)


  Fly    15 KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTS 79
            ::.:|...|:|:..:|.:.|.|..:|..:.:..:...| ||:|....|...||||.|.||:.::.
Zfish   104 EHAFNLQESDRLGSERAIRDTRHYRCASMTFDPDLPPT-SIIITFHNEARSTLLRTIKSVLMRSP 167

  Fly    80 PYLLKEIVLVHDGHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLNGHME 144
            |:|:.||:||.|...|.:..| :..::|.|..|..|..:|:|.:|:.||..|:..||.||:.|.|
Zfish   168 PHLILEIILVDDFSSDPEDCR-LLSQIPKVRCLRNERREGLIRSRVRGASAASASILTFLDSHCE 231

  Fly   145 VTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIF--LPLDQH-SW 206
            |...||.|:::.:..::..|..||:|.||.::|||.......:..|||.|...:  :|::|. :.
Zfish   232 VNTDWLQPMIQRVKEDHSRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPIEQKMAR 296

  Fly   207 NSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGI 271
            |...:|..:..:.|.:|.|::.||.|||.:|..:..:||:..|||.:||.|||.:..:||||||.
Zfish   297 NDPTQPIRTPVIAGGIFVIEKGWFNHLGQYDTHMDIWGGENFELSFRVWMCGGSLEILPCSRVGH 361

  Fly   272 IYKRDELEAQMAPNRNP-------SLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDKP 329
            ::::          |:|       :|...||.:|..:||:|:||.::|...|..:.....|:...
Zfish   362 VFRK----------RHPYDFPEGNALTYIKNTRRAAEVWMDDYKQYYYAARPSAQGKAFGSIADR 416

  Fly   330 RDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPHFCLSIKGGFPV------- 387
            ..|:|:|||.||.||...|.|:::                :|.....:.|..:||..:       
Zfish   417 LALKRKLNCNSFRWYLENVYPELK----------------IPEQEEAYSLLKQGGLCLESHGTDS 465

  Fly   388 --IRKCHST----NFEDWTLTSRCQLKHGNMCLDV---DYKNNVRATKCTKKLSKNPWHYN---Y 440
              :.:|.||    ..:.|||... |::..::||.:   ...:.||...|..|.|:..|...   .
Zfish   466 LGLAECRSTPSIPASQKWTLIEP-QIRQHDLCLAITAFTAGSKVRLEPCNIKESRQKWKPRGPAL 529

  Fly   441 QHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRW 476
            ||  .:|  ..||..........::.|...|..|.|
Zfish   530 QH--MIS--GLCLDSQPPSGPPAIAQCRPQVASQSW 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 99/294 (34%)
pp-GalNAc-T 54..349 CDD:133004 106/305 (35%)
RICIN 367..478 CDD:238092 28/130 (22%)
Ricin_B_lectin 373..476 CDD:279046 26/122 (21%)
galnt16XP_001339749.3 Glyco_tranf_2_3 139..365 CDD:290369 83/228 (36%)
pp-GalNAc-T 142..436 CDD:133004 106/305 (35%)
Ricin_B_lectin 452..561 CDD:279046 25/114 (22%)
RICIN 455..562 CDD:238092 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94110269
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.