DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt15

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_006519762.1 Gene:Galnt15 MGIID:1926004 Length:652 Species:Mus musculus

Alignment Length:514 Identity:154/515 (30%)
Similarity:233/515 (45%) Gaps:78/515 (15%)


  Fly    19 NAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSPYLL 83
            |..||.|:||:|.|.:.|.|.||: .:.:....|.|:::....|...||||.::|::......||
Mouse   160 NKPLSARLPLRRVLPEVRHPLCLQ-QHPTSGLPTASVILCFHDEAWPTLLRTVHSILDTAPRALL 223

  Fly    84 KEIVLVHD-GHPDL--DLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLNGHMEV 145
            :||:||.| ...:|  ..:.....:|..|..|......|.|.||:.||..||||:|||::.|.|.
Mouse   224 QEIILVDDLSQQELLKSALSEYVARLEAVKLLRSNRRLGTIGARMLGATRATGDVLVFMDAHCEC 288

  Fly   146 TRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY--RKLVEPEQLAFDWQLDHIFLPLDQHSWNS 208
            ..|||.|||..|..:...|..|::|.|..::..|  .||   .:...||:||..:.||.:....:
Mouse   289 HPGWLEPLLSRIADDRSRVVSPVIDVIDWKTLQYSASKL---HRGTLDWKLDFRWKPLGEQEQKA 350

  Fly   209 LPKPYP---SSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVG 270
            ||.|..   |..:...|.|:||.:|.:.|.:|..|.....:.||:|.|.|.|||.:..:||||||
Mouse   351 LPSPISPVRSPVVPREVVAVDRHYFQNTGAYDPLLSLGDSENLEMSFKAWLCGGSVEILPCSRVG 415

  Fly   271 IIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDKP-----R 330
            .||:..  :|...|:...:|   ||...:.:.||..:|..|||:.|:.  .|...:.||     .
Mouse   416 HIYRSQ--DASSRPDPEVAL---KNKIIIAETWLSSFKETFYRHIPEA--FTLSKVAKPDCTERL 473

  Fly   331 DLRRRLNCKSFEWYRSQVAPQI-----RNHF---LHAGLTNYPIGKIMPFVAPHFCLSIKG---- 383
            .|:|||.|::|.|:.:.|.|::     |..|   ||    |...|         .|...:.    
Mouse   474 KLQRRLGCRTFHWFLANVYPELYPSDHRPRFSGKLH----NTGFG---------LCADCQADGDI 525

  Fly   384 -GFPV-IRKCHSTNFEDWTL---------------TSRCQLKHG---NMCLDVDYKNNVRATKCT 428
             |.|: :..|.:...:..||               |.|.::..|   .:|.|| ....|....||
Mouse   526 LGCPMTLAPCSNNRQQQGTLLAMLTATPSAQNLEHTGRKEILFGGPQRLCFDV-RGGRVILQNCT 589

  Fly   429 KK-LSKNPWHYNYQHSSFVSN--GNKCLQIDV---NKVGLILSACDSDVTEQRWMFTKV 481
            :: .:.:..|:::|....:.:  ..||::..|   || .|.|..||.. |.|.|.|.::
Mouse   590 EEGPAIHQQHWDFQEDGMIIHVLSGKCMEAGVQPSNK-DLYLRQCDGK-TSQLWRFDQI 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 100/297 (34%)
pp-GalNAc-T 54..349 CDD:133004 104/308 (34%)
RICIN 367..478 CDD:238092 30/141 (21%)
Ricin_B_lectin 373..476 CDD:279046 28/133 (21%)
Galnt15XP_006519762.1 Glyco_tranf_2_3 191..436 CDD:290369 87/253 (34%)
pp-GalNAc-T 194..492 CDD:133004 104/308 (34%)
Ricin_B_lectin 504..641 CDD:279046 33/153 (22%)
RICIN 506..643 CDD:238092 33/153 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94063935
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.