DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt10

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001072444.1 Gene:galnt10 XenbaseID:XB-GENE-1010672 Length:603 Species:Xenopus tropicalis

Alignment Length:515 Identity:158/516 (31%)
Similarity:263/516 (51%) Gaps:42/516 (8%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPH 65
            ||:.|.|| |...|. .:|.::|::|.|.|:|.|.|:..| |..:...|....|::|....|...
 Frog    95 MTDADHVD-QAYREN-GFNIFVSDKISLNRSLPDIRNSNC-KNKFYFSKLPNTSVIIPFHNEGWS 156

  Fly    66 TLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKL-------PIVIQLEMESSKGIIHA 123
            :|||.::||:.::.|.|:.||||| |.:.|.   .|:..:|       |.|..:..:..:|:|..
 Frog   157 SLLRTVHSVLNRSPPELIAEIVLV-DDYSDK---AHLKSRLEKYMANFPKVKIVRTKKREGLIRT 217

  Fly   124 RLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY-RKLVEPEQ 187
            |:.||.||:|::|.||:.|.|....||||||:|::.|.:||..|::|.|..::|.| .:..:..:
 Frog   218 RMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMR 282

  Fly   188 LAFDWQLDHIFLPLDQHSWNSLPK-PYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELS 251
            .||||::.:..:|:........|. |:.|..:.|.:|||:|:|||.|||:|.||..:||:..|:|
 Frog   283 GAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEIS 347

  Fly   252 LKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPS-LQVQKNFKRVVDVWLDEYKLHFYRYN 315
            .|||.|||.::..||||||.||::      ..|.:.|: :.:.:|.|||.:||:|||..:.|:..
 Frog   348 FKVWMCGGRMVDSPCSRVGHIYRK------YVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRR 406

  Fly   316 PKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPHFCLS 380
            |..|:|:...:...::|||:|.|:.|:|:.:::|..:..::....|.....|:|.. |....|:.
 Frog   407 PDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRN-VRMDMCVG 470

  Fly   381 IK---GGFPV-IRKCH-STNFEDW------TLTSRCQLKHG------NMCLD-VDYKNNVRATKC 427
            :|   .|..: :..|: ..|.:.|      ||..|..::.|      ..|.| |...:.|....|
 Frog   471 VKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDC 535

  Fly   428 TKKLSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRWMFTKVQDFKLD 487
            ........|.|....:.:....|.|:..:..:..:.::.|:.....|:|.|..:....|:
 Frog   536 HGMKGNQLWKYRRDKTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILE 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 107/294 (36%)
pp-GalNAc-T 54..349 CDD:133004 111/305 (36%)
RICIN 367..478 CDD:238092 25/129 (19%)
Ricin_B_lectin 373..476 CDD:279046 22/121 (18%)
galnt10NP_001072444.1 pp-GalNAc-T 145..440 CDD:133004 111/305 (36%)
Glyco_tranf_2_2 145..408 CDD:287123 102/273 (37%)
Ricin_B_lectin 456..584 CDD:279046 24/129 (19%)
RICIN 458..586 CDD:238092 25/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.