DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7579 and galnt10

DIOPT Version :9

Sequence 1:NP_648799.1 Gene:CG7579 / 39714 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001070072.1 Gene:galnt10 / 767665 ZFINID:ZDB-GENE-030131-595 Length:261 Species:Danio rerio


Alignment Length:179 Identity:62/179 - (34%)
Similarity:102/179 - (56%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVDAQLQNEKYQ---YNAWLSERIPLKRTLEDYRDPQC-LKINYSSEKTVTVSIVIAIQQEHPHT 66
            |.||:..::.|:   :|.::|:||.|.|:|.|.|.|.| ||: |:::...| |::|....|...:
Zfish    89 LTDAERVDQAYRENGFNIFVSDRIALNRSLPDIRHPNCKLKL-YTADLPNT-SVIIPFHNEGWSS 151

  Fly    67 LLRGIYSVITQTSPYLLKEIVLVHD----GHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTG 127
            |||.::||:.::.|.|:.||:||.|    ||....|.::: .:||.|..|..:..:|:|..||.|
Zfish   152 LLRTVHSVLDRSPPSLIAEIILVDDFSDKGHLKAPLEQYM-VRLPKVRILRTQKREGLIRTRLLG 215

  Fly   128 AGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRES 176
            |..|.|.::.||:.|.|....||||||:.|.   |.....::|:.::.:
Zfish   216 AAAARGQVITFLDSHCEANVNWLPPLLDRIA---QNTNSSVLDSFNQRT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 44/129 (34%)
pp-GalNAc-T 54..349 CDD:133004 43/127 (34%)
RICIN 367..478 CDD:238092
Ricin_B_lectin 373..476 CDD:279046
galnt10NP_001070072.1 WcaA 134..>260 CDD:223539 44/130 (34%)
Glyco_tranf_GTA_type 139..>253 CDD:299700 42/117 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.