DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt14

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_082140.2 Gene:Galnt14 MGIID:1918935 Length:550 Species:Mus musculus

Alignment Length:508 Identity:144/509 (28%)
Similarity:236/509 (46%) Gaps:86/509 (17%)


  Fly    16 YQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSP 80
            |.:|...||||...|.:.|.|..:|..:.|.::...| ||:|....|...||||.|.||:.:|..
Mouse    77 YAFNQRESERISSNRAVPDTRHKRCSLLVYCTDLPPT-SIIITFHNEARSTLLRTIRSVLNRTPM 140

  Fly    81 YLLKEIVLVHDGHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLNGHMEV 145
            :|::||:||.|...|.:..:.: .|||.|..|.....:|::.:|:.||.:|.|..|.||:.|.||
Mouse   141 HLIQEIILVDDFSNDPEDCKQL-IKLPKVKCLRNNERQGLVRSRMRGADIAQGTTLTFLDSHCEV 204

  Fly   146 TRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIF--LPLDQHSWNS 208
            .|.||.|||..:..:...|..|::|.|:.::|.|.:.....:..|||.|...:  |.|:|.:...
Mouse   205 NRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFNYIESASELRGGFDWSLHFQWEQLSLEQKALRL 269

  Fly   209 LP-KPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGII 272
            .| :|..:..:.|.:|.||:.||.:||.:|..:..:||:..|:|.:||.|||.:..:||||||.:
Mouse   270 DPTEPIRTPIIAGGLFVIDKAWFDYLGKYDVDMDIWGGENFEISFRVWMCGGGLEIIPCSRVGHV 334

  Fly   273 YKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDKPRDLRRRLN 337
            :::.  ...:.|:.|.:..: ||.||..:||:||||.::|...|........:::...:||:.|:
Mouse   335 FRKK--HPYVFPDGNANTYI-KNTKRTAEVWMDEYKQYYYAARPFALERPFGNIENRLNLRKNLH 396

  Fly   338 CKSFEWYRSQVAPQIR---NHFLHAG-------------------LTNYPIGKI----------- 369
            |::|:||...|.|::|   :..:..|                   |...|..|:           
Mouse   397 CQTFKWYLENVYPELRVPPDSSIQKGNIRQRQKCLESQKQKKQEILRLSPCAKVKGDGAKSQVWA 461

  Fly   370 ----MPFVAPHFCLSIKGGFP----VIRKCHSTNFED-WTLTSRCQLKH--GNMCLDVDYKNNVR 423
                ...:....|||:...||    |:..|.:.:... ||.|. .:::|  .::|||.|...:  
Mouse   462 FTYTQQIIQEELCLSVVTLFPGAPVVLALCKNGDERQLWTKTG-ARIEHIASHLCLDTDMFGD-- 523

  Fly   424 ATKCTKKLSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRW 476
            :|:..|::..||                               |:|.:..|.|
Mouse   524 STEDGKEVVVNP-------------------------------CESSLMSQHW 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 98/287 (34%)
pp-GalNAc-T 54..349 CDD:133004 103/298 (35%)
RICIN 367..478 CDD:238092 24/133 (18%)
Ricin_B_lectin 373..476 CDD:279046 22/110 (20%)
Galnt14NP_082140.2 Catalytic subdomain A 110..215 43/107 (40%)
Glyco_tranf_2_3 111..337 CDD:290369 82/228 (36%)
pp-GalNAc-T 114..408 CDD:133004 103/298 (35%)
Catalytic subdomain B 274..336 25/62 (40%)
RICIN 422..547 CDD:238092 27/159 (17%)
Ricin_B_lectin 422..545 CDD:279046 26/157 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.