DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt8a.2

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_021326339.1 Gene:galnt8a.2 ZFINID:ZDB-GENE-131122-40 Length:609 Species:Danio rerio

Alignment Length:551 Identity:156/552 (28%)
Similarity:247/552 (45%) Gaps:106/552 (19%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQC-LKINYSSEKTVTVSIVIAIQQEHP 64
            :||.:.::|:...:::.||.:||.|:||.||:.|.|||:| ||| |..: ..|:|:::....|..
Zfish    99 LTEEEQMEAEKLFQEFGYNVFLSNRLPLNRTIPDTRDPRCSLKI-YPKD-LPTISVILIYLNEAL 161

  Fly    65 HTLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKLP--------------IVIQLEME 115
            ..:.|.:.|:|.:|..:||||||||.|...:.||      |||              ::.::..:
Zfish   162 SVIKRAVQSIIDKTPAHLLKEIVLVDDNSSNEDL------KLPLDKYIDLINKGKPGLIKKVRHK 220

  Fly   116 SSKGIIHARLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYR 180
            ...|:..||::|...|||.::..|:.|:||.:.|..|||..|..|..||..|:.|.:..::....
Zfish   221 KQMGLAKARMSGWEAATGQVVAILDAHIEVHKEWAEPLLAQIKANRTTVLSPVFDKVLFDTLEVI 285

  Fly   181 KLVEPEQLAFDWQL---DHIFLPLDQHSWNSL---PKPYPSSQLEGRVFAIDRKWFWHLGGWDEG 239
            | ..|...||||.|   ...|.|    .|..|   .:|..|..:.| :...||::...:|..|||
Zfish   286 K-YNPAAHAFDWSLWCMYERFRP----EWYKLKDPSEPGKSPSVMG-ILVADREFLGEIGVLDEG 344

  Fly   240 LRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPSLQ--VQKNFKRVVDV 302
            :..|||:.:||.::||.|||.:..||||::.      .:|....| .:|.|.  :.:|..||.::
Zfish   345 MTIYGGENVELGIRVWLCGGSVEVVPCSKIA------HVERAHKP-YSPDLSKLMIRNALRVAEI 402

  Fly   303 WLDEYKLHF-YRYNPKLRN--LTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIR--NHFLHAGLT 362
            |:||||.:. ..:|..|::  :...::.:.:.||.:|.||.|:||...|.|.:.  :..|..|:.
Zfish   403 WMDEYKSNVNIAWNLPLKDHGIDIGNVTERKQLREKLKCKPFKWYLENVYPLLDRWDDILGYGVL 467

  Fly   363 NYPIGKIMPFVAPHFCLS---IKGGFPVIRKCHSTNFEDWTLTSRCQLK---------------H 409
            ...|.|.       .|:.   :.|..||:..||      :....||..|               :
Zfish   468 KNDILKT-------HCIDQGPVPGSVPVLFGCH------YYGPQRCYYKRTGEIYVGSIKSHTYN 519

  Fly   410 GNMCL-DVDYKNNVRATKCTKKLSKNP-----WHYNYQHSSFVSNGNKCLQIDVNK---VGLILS 465
            .|.|| |....:.|....|  |.:|..     |.:...........|:|:::...:   ..|:|.
Zfish   520 SNRCLTDPGSGSTVTLYNC--KYAKEKGFSIYWDFTQGKEIRNKKTNRCIELAQGQDTYYYLVLQ 582

  Fly   466 ACDSDVTEQRWM-----------FTKVQDFK 485
            ||    |.|.|.           ||:|:..|
Zfish   583 AC----TGQEWTIQHAFEELKGNFTEVKATK 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 92/309 (30%)
pp-GalNAc-T 54..349 CDD:133004 98/320 (31%)
RICIN 367..478 CDD:238092 28/149 (19%)
Ricin_B_lectin 373..476 CDD:279046 26/130 (20%)
galnt8a.2XP_021326339.1 pp-GalNAc-T 151..452 CDD:133004 98/320 (31%)
RICIN 475..591 CDD:238092 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.