DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt8b.1

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_021331085.1 Gene:galnt8b.1 ZFINID:ZDB-GENE-041210-83 Length:629 Species:Danio rerio

Alignment Length:535 Identity:152/536 (28%)
Similarity:231/536 (43%) Gaps:124/536 (23%)


  Fly    14 EKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQT 78
            :||.|||:||:|:||.|.|.|.||.:|.:..|..: ..|||:|:....|....:.|.:||:|.:|
Zfish   108 QKYGYNAFLSDRLPLDRELPDTRDHRCAEREYPPD-LPTVSVVLIYLDEALSVIQRAVYSIINRT 171

  Fly    79 SPYLLKEIVLVHDGHPDLDL-------IRHIHHKLPIVIQLEMES-SKGIIHARLTGAGVATGDI 135
            ..:|||||:||.|...:.||       |..|:.|.|.::::...: .||:..||::|...|:||:
Zfish   172 PAHLLKEIILVDDHSTNEDLQTQLHVYISSINEKHPGLVKMVTHAEQKGLSQARISGWKAASGDV 236

  Fly   136 LVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIFLP 200
            :..|:.|:||...|..|||..|..:...|..|:.|.|:.:.....|...... .|||.|..:::.
Zfish   237 VAILDAHIEVHVKWAEPLLARIQADRTLVLSPVFDKINYDDLEVTKYFASAH-GFDWALWCMYVT 300

  Fly   201 LDQHSWN----SLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLK-------- 253
            ..:..:|    |||...||..   .:..:||.:|..:|..|||::.|||:.:||.::        
Zfish   301 FPKKWYNRNDPSLPGKSPSVM---GILVVDRLFFGEIGTLDEGMQVYGGENVELGIRVIHHHTEA 362

  Fly   254 --------------------------VWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPSLQ- 291
                                      ||.|||.|..||||::.      .:|....|.. |.|. 
Zfish   363 FIILLYLHVEQWCCCSLLTLGCVLAQVWLCGGSIEVVPCSKIA------HIERAHKPYM-PDLSN 420

  Fly   292 -VQKNFKRVVDVWLDEYKLHFY-RYNPKLRN--LTAESLDKPRDLRRRLNCKSFEWYRSQV---- 348
             :::|..||.:||:||||.:.| .:...|.|  :....|.:.:.||.|||||.|:||...|    
Zfish   421 VMKRNALRVAEVWMDEYKKNVYMAWGLPLENHGIDIGDLSERKKLRERLNCKPFKWYLENVYTEL 485

  Fly   349 ------------------------APQIRN-------HFLHAGLTNYP------IGKIMPFV-AP 375
                                    .|...|       |||.:.:..|.      :|.:.|.: :.
Zfish   486 NPMDDLLGYGALINDLQTSLCLDKGPSEENTPILYPCHFLTSQVFFYTTSGEILVGPLQPLLHSR 550

  Fly   376 HFCLSIKGG--FPVIRKCHSTN-----FEDWTLTSRCQLKHGNMCLDV------DYKNNVRATKC 427
            :.||:..|.  ||....|..|.     :.|:......|.:....||::      ||||||...:|
Zfish   551 NRCLADPGSGRFPEFSWCSDTEKPKHMYWDFKQGQAIQNRDTKRCLEISPKQTGDYKNNVFVQEC 615

  Fly   428 TKKLSKNPWHYNYQH 442
            ..:      |:..||
Zfish   616 RNQ------HWRIQH 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 98/335 (29%)
pp-GalNAc-T 54..349 CDD:133004 104/374 (28%)
RICIN 367..478 CDD:238092 23/91 (25%)
Ricin_B_lectin 373..476 CDD:279046 21/85 (25%)
galnt8b.1XP_021331085.1 pp-GalNAc-T 147..482 CDD:133004 104/346 (30%)
Ricin_B_lectin 494..620 CDD:306998 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.