DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt1

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_009290644.1 Gene:galnt1 ZFINID:ZDB-GENE-030131-2360 Length:557 Species:Danio rerio

Alignment Length:509 Identity:168/510 (33%)
Similarity:251/510 (49%) Gaps:53/510 (10%)


  Fly     6 LVDAQLQNEKY-------QYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEH 63
            :|.|:.|.||.       |:|...||.|.|.|:|.|.|...|....|..:...| |:||....|.
Zfish    63 VVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRT-SVVIVFHNEA 126

  Fly    64 PHTLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHH---KLPIVIQ-LEMESSKGIIHAR 124
            ..||||.::|||.::..:||:|||||.|......|.|.:.|   ||.:.:: :.||...|:|.||
Zfish   127 WTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRAR 191

  Fly   125 LTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLA 189
            |.||.::||.::.||:.|.|.|.|||.|||..|.|:.:||..||:|.||.::|.|....:.....
Zfish   192 LKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGG 256

  Fly   190 FDWQLDHIFLPLDQHSWN------SLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDAL 248
            |:|:|:..:.|:.|...:      :||...|:  :.|.:|:|||.:|..:|.:|.|:..:||:.|
Zfish   257 FNWKLNFRWYPVPQREMDRRKGDRTLPVRTPT--MAGGLFSIDRDYFQEIGTYDAGMDIWGGENL 319

  Fly   249 ELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLH 310
            |:|.::|||||.:..|.||.||.::::      ..|...|   ...:.||.:|:.:||:||:|..
Zfish   320 EISFRIWQCGGTLEIVTCSHVGHVFRK------ATPYTFPGGTGQIINKNNRRLAEVWMDEFKNF 378

  Fly   311 FYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAP--QIRNHFLHAGLTNYPIGKIMPFV 373
            ||..:|.:..:....:.....||:||.||.|.||...|.|  ||..|:       |.:|:|.. |
Zfish   379 FYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHY-------YSLGEIRN-V 435

  Fly   374 APHFCL-------SIKGGFPVIRKCHSTNFED-WTLTSRCQLKHGNMCLDVDYKNN-VRATKCTK 429
            ..:.||       :.|.|   |..||...... ::.|:..:::..::||||...|. |...||..
Zfish   436 ETNQCLDNMARKENEKVG---IFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVMMLKCHH 497

  Fly   430 KLSKNPWHYNYQHSSFVS-NGNKCLQIDVNKVGLILSACD-SDVTEQRWMFTKV 481
            ......|.|:....|.|. |.|:||.........:.|..| |....|:|:...|
Zfish   498 LKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRNV 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 106/297 (36%)
pp-GalNAc-T 54..349 CDD:133004 112/308 (36%)
RICIN 367..478 CDD:238092 32/122 (26%)
Ricin_B_lectin 373..476 CDD:279046 29/114 (25%)
galnt1XP_009290644.1 pp-GalNAc-T 117..417 CDD:133004 112/308 (36%)
RICIN 430..548 CDD:238092 32/122 (26%)
Ricin_B_lectin 430..546 CDD:279046 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.