DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and GALNT7

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_059119.2 Gene:GALNT7 HGNCID:4129 Length:657 Species:Homo sapiens

Alignment Length:523 Identity:160/524 (31%)
Similarity:247/524 (47%) Gaps:86/524 (16%)


  Fly    10 QLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSV 74
            |...:::.:|...|:.|.|.|::.|.|..:|...:| .|..:|.|:||....|...||:|.::||
Human   167 QASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHY-DENLLTSSVVIVFHNEGWSTLMRTVHSV 230

  Fly    75 ITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKLPIVIQL--------EMESSKGIIHARLTGAGVA 131
            |.:|....|.||||:    .|.....|:..||...|:|        ..|..:|:|.||..||..|
Human   231 IKRTPRKYLAEIVLI----DDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKA 291

  Fly   132 -TGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPE--------- 186
             .|.:|::|:.|.||...|..||:.||..:....|.|::|.|:..::.    :.|:         
Human   292 KLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYE----IIPQGGGDEDGYA 352

  Fly   187 QLAFDWQLDHIFLPLDQHSWNSLP-------------KPYPSSQLEGRVFAIDRKWFWHLGGWDE 238
            :.|:||.:          .|..:|             :||.|..:.|.:|||:|::|:.||.:|.
Human   353 RGAWDWSM----------LWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDP 407

  Fly   239 GLRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAP---NRNPSLQVQKNFKRVV 300
            ||:.:||:..|:|.|:|||||.:|.|||||||.||:.:..:....|   ..:|:|   ||:.|||
Human   408 GLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTL---KNYVRVV 469

  Fly   301 DVWLDEYKLHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYP 365
            :||.||||.:||...|:.:.|....:.:.:..|...|||||:|:..::|..|.:|        ||
Human   470 EVWWDEYKDYFYASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSH--------YP 526

  Fly   366 I-------GKIMPFVAPHFCL----SIKGGFPVIRKCHSTNFED-WTLTSRCQLKHGNMCLDVDY 418
            :       |:|..|... :|:    ...|||..:..||...... :.:....||...:.||....
Human   527 LPPKNVDWGEIRGFETA-YCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGA 590

  Fly   419 K-NNVRATKCTKKLSKNPWHY--NYQHSSFVSNGNKCLQIDVNKV--GLILSACDSDVTEQRWMF 478
            . :.|..|.|.....|. |.|  |....:.:.:| |||  |.::|  .:.:|.|||..|.|:|..
Human   591 DGSKVMITHCNLNEFKE-WQYFKNLHRFTHIPSG-KCL--DRSEVLHQVFISNCDSSKTTQKWEM 651

  Fly   479 TKV 481
            ..:
Human   652 NNI 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 105/318 (33%)
pp-GalNAc-T 54..349 CDD:133004 110/329 (33%)
RICIN 367..478 CDD:238092 33/121 (27%)
Ricin_B_lectin 373..476 CDD:279046 29/113 (26%)
GALNT7NP_059119.2 Catalytic subdomain A 206..317 40/115 (35%)
pp-GalNAc-T 210..518 CDD:133004 110/329 (33%)
Catalytic subdomain B 381..443 34/62 (55%)
Ricin_B_lectin 534..649 CDD:306998 32/120 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.