DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and poc1bl

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001038243.2 Gene:poc1bl ZFINID:ZDB-GENE-050306-41 Length:582 Species:Danio rerio

Alignment Length:529 Identity:162/530 (31%)
Similarity:251/530 (47%) Gaps:88/530 (17%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPH 65
            :|..:..:.:...|:...|.::|::|.|.|.::|.|..:|....|:..:..|.|:|||...|...
Zfish    90 LTSEEKKEEEASVERCAINIFISDKISLHRHIQDNRMHECKAKKYNIRRLPTTSVVIAFYNEAWS 154

  Fly    66 TLLRGIYSVITQTSPYLLKEIVLVHD----GHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLT 126
            ||||.|:||:..|...|||:|:||.|    |:....|.::|.: |..|..:..:..:|::.|||.
Zfish   155 TLLRTIHSVLETTPAVLLKDIILVDDFSDRGYLKSQLAQYISN-LERVRLIRTKKREGLVRARLI 218

  Fly   127 GAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFA-YRKLVEPEQLAF 190
            ||..|||.:|.||:.|.|...||:.||||.|..|..|:..|::|.|...:|. |.:..||....|
Zfish   219 GATYATGSVLTFLDCHCECVPGWIEPLLERIAENETTIICPVIDTIDWNTFEFYMQTEEPMVGGF 283

  Fly   191 DWQLDHIFLPLDQHSWNSLPK-----------PYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYG 244
            ||:|        ...|:::|:           |..|..:.|.:||:.:.:|.:||.:|.|:..:|
Zfish   284 DWRL--------TFQWHAVPEIDRKIRKSRIDPIRSPTMAGGLFAVSKAYFEYLGTYDMGMEVWG 340

  Fly   245 GDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAP-NRNPSLQVQKNFKRVVDVWLDEYK 308
            |:.||||.:||||||.:...|||.||.::.:      .|| .|:..||   |..|..:||:|.||
Zfish   341 GENLELSFRVWQCGGSLEIHPCSHVGHVFPK------KAPYARSNFLQ---NTVRAAEVWMDTYK 396

  Fly   309 LHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAP-------------QIRNHFLHAG 360
            .|||..||..|..:...:.:...||.||.|||||||...|.|             .:|:..:|:.
Zfish   397 QHFYNRNPPARKESYGDISERIVLRNRLQCKSFEWYLQNVYPGLHVPEDRPGWHGAVRSAGIHSE 461

  Fly   361 LTNY------PIGKIMPFVAPHFCLSIKGGFPVIRKCHSTN----FEDWTLTSRCQLKHGN---M 412
            ..:|      |.|       .|  ||:.|       ||...    ||   .||:.:::..:   :
Zfish   462 CLDYNAPDHNPTG-------AH--LSLFG-------CHGQGGNQYFE---YTSQREIRFNSVTEL 507

  Fly   413 CLDV-DYKNNVRATKCTKK-LSKNP---WHYNYQHSSFVSNGNKCL---QIDVNKVGLILSACDS 469
            |.:| |...::....|.:. :.|.|   |.:....|.|..:.|.|:   :.:..:..:.:.:|.:
Zfish   508 CAEVQDGMTHIGMKHCPQDGVPKPPSIIWQFREDGSIFHPHSNMCITSYRTEEGRADIQMRSCST 572

  Fly   470 DVTEQRWMF 478
            ....|||.|
Zfish   573 GDKHQRWSF 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 110/301 (37%)
pp-GalNAc-T 54..349 CDD:133004 118/312 (38%)
RICIN 367..478 CDD:238092 26/126 (21%)
Ricin_B_lectin 373..476 CDD:279046 24/118 (20%)
poc1blNP_001038243.2 WcaA 139..434 CDD:223539 118/313 (38%)
pp-GalNAc-T 143..437 CDD:133004 118/312 (38%)
RICIN 451..581 CDD:238092 30/149 (20%)
Ricin_B_lectin 451..579 CDD:279046 29/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.