DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galntl5

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 RGDID:1565271 Length:443 Species:Rattus norvegicus

Alignment Length:372 Identity:130/373 (35%)
Similarity:200/373 (54%) Gaps:28/373 (8%)


  Fly    15 KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTS 79
            :|..|...|.|:.::|.:.|.|:..|.:.:|.. ...|.|::|....|..:||||.:.||:..:.
  Rat    85 RYGLNVITSRRLGIERQVPDSRNKICQQKHYPF-NLPTASVIICFYNEEFNTLLRTVSSVMNLSP 148

  Fly    80 PYLLKEIVLVHDGHPDLDLIRHIHHKLPI----VIQLEMESSKGIIHARLTGAGVATGDILVFLN 140
            .:||:||:||.|.....||...:.:.|.|    :..:..:..:|:|.:|:.||..|:|||||||:
  Rat   149 KHLLEEIILVDDMSEFDDLKAKLDYHLEIFRGKIKLVRNKKREGLIRSRMIGASRASGDILVFLD 213

  Fly   141 GHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY--RKLVEPEQLAFDWQL----DHIF- 198
            .|.||.|.||.|||..|..:::.|..|::|.|...:..|  ..:|..   ||||.|    |.:| 
  Rat   214 SHCEVNRVWLEPLLHAIAKDHKMVVCPVIDVIDELTLDYVGSPIVRG---AFDWNLNFRWDDVFS 275

  Fly   199 LPLDQHSWNSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILA 263
            ..||.....|.|...|:  :.|.:|||:|.:|..||.:|:.:..:||:.:||||::|.|||.:..
  Rat   276 YELDGPEGPSTPIRSPA--MSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIWMCGGQLFI 338

  Fly   264 VPCSRVGIIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDK 328
            :||||||  :....|......|::   .:.||..|||.|||||||.:|:...|.|.:::..::..
  Rat   339 LPCSRVG--HNNKALSKNRLVNQS---ALSKNLLRVVHVWLDEYKENFFLQRPSLTHVSCGNISD 398

  Fly   329 PRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPI----GKIMP 371
            ..:||:||.||||:||...:.|::..  |:.|....|.    ||.:|
  Rat   399 RVELRKRLGCKSFQWYLDNIFPELEP--LNRGKGTKPFLLAKGKNVP 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 107/295 (36%)
pp-GalNAc-T 54..349 CDD:133004 113/306 (37%)
RICIN 367..478 CDD:238092 3/6 (50%)
Ricin_B_lectin 373..476 CDD:279046
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 113/306 (37%)
Glyco_tranf_2_3 123..355 CDD:290369 87/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94161543
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.