| Sequence 1: | NP_648799.1 | Gene: | CG7579 / 39714 | FlyBaseID: | FBgn0036528 | Length: | 498 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001020319.1 | Gene: | Galntl5 / 499968 | RGDID: | 1565271 | Length: | 443 | Species: | Rattus norvegicus | 
| Alignment Length: | 372 | Identity: | 130/372 - (34%) | 
|---|---|---|---|
| Similarity: | 200/372 - (53%) | Gaps: | 28/372 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    15 KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTS 79 
  Fly    80 PYLLKEIVLVHDGHPDLDLIRHIHHKLPI----VIQLEMESSKGIIHARLTGAGVATGDILVFLN 140 
  Fly   141 GHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY--RKLVEPEQLAFDWQL----DHIF- 198 
  Fly   199 LPLDQHSWNSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILA 263 
  Fly   264 VPCSRVGIIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDK 328 
  Fly   329 PRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPI----GKIMP 371 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG7579 | NP_648799.1 | WcaA | 52..336 | CDD:223539 | 106/294 (36%) | 
| pp-GalNAc-T | 54..349 | CDD:133004 | 113/305 (37%) | ||
| RICIN | 367..478 | CDD:238092 | 3/5 (60%) | ||
| Ricin_B_lectin | 373..476 | CDD:279046 | |||
| Galntl5 | NP_001020319.1 | pp-GalNAc-T | 123..419 | CDD:133004 | 113/305 (37%) | 
| Glyco_tranf_2_3 | 123..355 | CDD:290369 | 87/238 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166346040 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3736 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.740 | |||||