DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Pgant35A

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_652069.2 Gene:Pgant35A FlyBaseID:FBgn0001970 Length:632 Species:Drosophila melanogaster

Alignment Length:503 Identity:149/504 (30%)
Similarity:234/504 (46%) Gaps:74/504 (15%)


  Fly    16 YQYNAWLSERIPLKRTLEDYRDPQC-LKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTS 79
            :.:||.:|..|.|.|.:.|.|...| .:....:|.....|||:....||..||:|.|.:|:.:|.
  Fly   112 HAFNALVSNNIGLFRAIPDTRHKVCDRQETTEAENLPQASIVMCFYNEHKMTLMRSIKTVLERTP 176

  Fly    80 PYLLKEIVLVHDGHPDL-DLIRHIHHKLPIVIQ------LEMESSKGIIHARLTGAGVATGDILV 137
            .|||:||:|| |.|.|| :|..|:|..|...::      ::.|..:|:|.:|:.||..|.||:||
  Fly   177 SYLLREIILV-DDHSDLPELEFHLHGDLRARLKYDNLRYIKNEQREGLIRSRVIGAREAVGDVLV 240

  Fly   138 FLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQL---AFDWQLDHIFL 199
            ||:.|:||.:.||.|||..|...|.|:..|::|.|:.::|.|    .|..|   .|:|.|     
  Fly   241 FLDSHIEVNQQWLEPLLRLIKSENATLAVPVIDLINADTFEY----TPSPLVRGGFNWGL----- 296

  Fly   200 PLDQHSWNSLPK-----------PYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLK 253
               ...|.:||:           |:.|..:.|.:||::||:|.|||.:|..:..:||:.:|:|.:
  Fly   297 ---HFRWENLPEGTLKVPEDFRGPFRSPTMAGGLFAVNRKYFQHLGEYDMAMDIWGGENIEISFR 358

  Fly   254 VWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP--SLQVQKNFKRVVDVWLDEYKLHFYRYNP 316
            .|||||.|..|||||||.|:::      ..|..:|  :..:.||..|:..||:|:||.::.::..
  Fly   359 AWQCGGAIKIVPCSRVGHIFRK------RRPYTSPDGANTMLKNSLRLAHVWMDQYKDYYLKHEK 417

  Fly   317 KLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHF----------------LHAGLTNYP 365
            ..:......:.....||.||.|:.|.||...|.|::  |.                .|:...||.
  Fly   418 VPKTYDYGDISDRLKLRERLQCRDFAWYLKNVYPEL--HVPGEESKKSAAAPIFQPWHSRKRNYV 480

  Fly   366 IGKIMPFVAPHFCLSI----------KGGFPVIRKCHSTNFEDWTLTSRCQLKHGN-MCLDVDYK 419
            ....:.......|.::          ||....::.|..|..:.|..|.:.::.... :||:....
  Fly   481 DTFQLRLTGTELCAAVVAPKVKGFWKKGSSLQLQTCRRTPNQLWYETEKAEIVLDKLLCLEASGD 545

  Fly   420 NNVRATKCTKKLSKNPWHYNYQHSSFVSNGNK--CLQIDVNKVGLILS 465
            ..|...||.:.|....|.:....:|.|.|..|  ||:......|.::|
  Fly   546 AQVTVNKCHEMLGDQQWRHTRNANSPVYNMAKGTCLRAAAPTTGALIS 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 106/307 (35%)
pp-GalNAc-T 54..349 CDD:133004 112/318 (35%)
RICIN 367..478 CDD:238092 22/113 (19%)
Ricin_B_lectin 373..476 CDD:279046 22/107 (21%)
Pgant35ANP_652069.2 pp-GalNAc-T 151..450 CDD:133004 112/318 (35%)
RICIN 489..610 CDD:214672 22/106 (21%)
RICIN 490..609 CDD:238092 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94127493
eggNOG 1 0.900 E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11675
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.