DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt6

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_998361.1 Gene:galnt6 ZFINID:ZDB-GENE-040426-2272 Length:619 Species:Danio rerio

Alignment Length:556 Identity:163/557 (29%)
Similarity:246/557 (44%) Gaps:133/557 (24%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTL-EDYRDPQCLKINYSSEKTV-TVSIVIAIQQEH 63
            ||:.:..:.|....::.:|.:.|:||.|.||| :|.|.|:|:...:.....: |.|::|....|.
Zfish   120 MTKEEEKEKQEGMTRHCFNQFASDRISLHRTLGDDTRPPECVDRKFRRCPALPTTSVIIVFHNEA 184

  Fly    64 PHTLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHK-------LPIVIQLEMESSKGII 121
            ..||||.:|||:..:....||||::|.|.    ....|:|.|       |.||..:.....||:|
Zfish   185 WSTLLRTVYSVLHTSPAAFLKEIIMVDDA----STAEHLHGKLEEYVKALKIVKVVRQPERKGLI 245

  Fly   122 HARLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPE 186
            .|||.||..|.|:||.||:.|.|...|||.|||..|:.....|..|.:..|...:|.:.|.|...
Zfish   246 TARLLGASKAEGEILTFLDAHCECFHGWLEPLLARIVEEPTAVVSPEITTIDLNTFQFHKPVATA 310

  Fly   187 QL----AFDWQLDHIFLPLDQHSWNSLP---------KPYP--SSQLEGRVFAIDRKWFWHLGGW 236
            :.    .|||.|        ...|..:|         :.||  :....|.:|:|.:.:|..:|.:
Zfish   311 RAHNRGNFDWSL--------TFGWEGIPDYENAKRKDETYPVKTPTFAGGLFSISKAYFEKIGTY 367

  Fly   237 DEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP--SLQVQKNFKRV 299
            |:.:..:||:.:|:|.:||||||.:..:|||.||.:::      ..:|:..|  :..:.:|..|:
Zfish   368 DDKMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFR------TKSPHTFPKGTEVITRNQVRL 426

  Fly   300 VDVWLDEYKLHFYRYNPKLRNLTAESLDKPR---------DLRRRLNCKSFEWYRSQVAPQIRNH 355
            .:||:|:|||.|||     |:.:|..:.|.:         .||..|.||:|.||.|.|.|:    
Zfish   427 AEVWMDDYKLIFYR-----RSQSAAKMAKEKGFGDISDRLKLREDLQCKNFSWYLSNVYPE---- 482

  Fly   356 FLHAGLTNYPIGKIMPFVAP-----------HFCLSI----KGGFPVIR-KCHSTN----FEDWT 400
                        ..:|.::|           ..||.:    .||.|||. .||:..    ||   
Zfish   483 ------------AFVPDLSPVKFGALKNRGAQQCLDVGESNNGGKPVIMYTCHNMGGNQYFE--- 532

  Fly   401 LTSRCQLKHG---NMCLDVD-YKNNVRATKCTKK------------------LSKNPWHYNYQHS 443
            .||..:|:|.   .:||... |...|:...||.|                  |.|||        
Zfish   533 YTSHKELRHNIGKQLCLQASPYPEPVKIELCTLKGKGSSLAPEQEWLITEEQLLKNP-------- 589

  Fly   444 SFVSNGNKCLQIDVNKVGLILSACDSDVTEQRWMFT 479
               |:| |||....:|:  ::|.|:.|...|:|.|:
Zfish   590 ---SSG-KCLHKKGDKI--LMSPCNPDDHHQQWAFS 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 99/317 (31%)
pp-GalNAc-T 54..349 CDD:133004 106/328 (32%)
RICIN 367..478 CDD:238092 39/153 (25%)
Ricin_B_lectin 373..476 CDD:279046 37/145 (26%)
galnt6NP_998361.1 pp-GalNAc-T 175..480 CDD:133004 106/328 (32%)
Ricin_B_lectin 493..616 CDD:279046 36/140 (26%)
RICIN 494..618 CDD:238092 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94129464
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.