DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and GALNT18

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_940918.2 Gene:GALNT18 HGNCID:30488 Length:607 Species:Homo sapiens

Alignment Length:514 Identity:155/515 (30%)
Similarity:248/515 (48%) Gaps:72/515 (14%)


  Fly    12 QNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVIT 76
            |.:.|.|||:||:|:||.|.|.|.|...|..::: .:....||||.....|....|||.|:|.:.
Human   116 QFQYYGYNAYLSDRLPLDRPLPDLRPSGCRNLSF-PDSLPEVSIVFIFVNEALSVLLRSIHSAME 179

  Fly    77 QTSPYLLKEIVLVHDGHPDLDL-------IRHIHHKLPIVIQLEMES-SKGIIHARLTGAGVATG 133
            :|.|:|||||:||.|...:.:|       :..::.:.|..|::...| .:|:|.:|::|...||.
Human   180 RTPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATA 244

  Fly   134 DILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLA---FDWQLD 195
            .::...:.|:|...||..|:|..|..|.:.:..|..|.|..::|.    :|...||   |||:|.
Human   245 PVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFE----IEEYPLAAQGFDWELW 305

  Fly   196 HIFLPLDQHSW---NSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQC 257
            ..:|...:..|   || ..|..|..|.| .|.:||::|..:|..|||:..|||:.:||.::||||
Human   306 CRYLNPPKAWWKLENS-TAPIRSPALIG-CFIVDRQYFQEIGLLDEGMEVYGGENVELGIRVWQC 368

  Fly   258 GGLILAVPCSRVGIIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFY-RYN-PK--- 317
            ||.:..:||||:..|.:     |......:.:..|::|..||.:||:||:|.|.| .:| |:   
Human   369 GGSVEVLPCSRIAHIER-----AHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMAWNIPQEDS 428

  Fly   318 ---LRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPHFCL 379
               :.::||.     :.||::|.||:|.||...|.|::|   :::.:..|  |.:...:....||
Human   429 GIDIGDITAR-----KALRKQLQCKTFRWYLVSVYPEMR---MYSDIIAY--GVLQNSLKTDLCL 483

  Fly   380 SIKG----GFPVIRKCHSTNFEDWTLTSRCQLKHG----------NMCLDVDYKNNVRATKCT-K 429
            . :|    ..|::..||....::...||..|:..|          |.|| ||..:..|..:|: .
Human   484 D-QGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCL-VDVNSRPRLIECSYA 546

  Fly   430 KLSKNPWHYNYQHSSFVSN--GNKCLQIDVNK-----VGLILSACDSDVTEQRWMFTKV 481
            |..:...|:.:.....:.|  ..:||::..|.     ..|:|..|..    |.|..|.|
Human   547 KAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSG----QHWSITNV 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 99/306 (32%)
pp-GalNAc-T 54..349 CDD:133004 105/317 (33%)
RICIN 367..478 CDD:238092 29/133 (22%)
Ricin_B_lectin 373..476 CDD:279046 27/125 (22%)
GALNT18NP_940918.2 Catalytic subdomain A 153..267 36/114 (32%)
pp-GalNAc-T 157..458 CDD:133004 105/317 (33%)
Catalytic subdomain B 324..385 28/62 (45%)
RICIN 471..598 CDD:238092 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.