DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt16

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001094333.1 Gene:Galnt16 RGDID:1310202 Length:558 Species:Rattus norvegicus

Alignment Length:494 Identity:144/495 (29%)
Similarity:233/495 (47%) Gaps:61/495 (12%)


  Fly    15 KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTS 79
            ::.:|...|:::...|.:.|.|...|..::|||:...| |::|....|...||||.:.||:.:|.
  Rat    88 QHAFNQLESDKLSPDRPIRDTRHYSCPSLSYSSDLPAT-SVIITFHNEARSTLLRTVKSVLNRTP 151

  Fly    80 PYLLKEIVLVHDGHPD----LDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLN 140
            ..|::||:||.|...|    |.|.|     :|.|..|..:..:|:|.:|:.||.||...:|.||:
  Rat   152 AGLIQEIILVDDFSSDPEDCLLLTR-----IPKVKCLRNDKREGLIRSRVRGADVAGASVLTFLD 211

  Fly   141 GHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIF--LPLDQ 203
            .|.||...||.|:|:.::.::..|..||:|.||.::|||.......:..|||.|...:  :||:|
  Rat   212 SHCEVNVEWLQPMLQRVMEDHTRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQ 276

  Fly   204 HSWNSLP-KPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCS 267
            ....:.| ||..:..:.|.:|.||:.||.|||.:|..:..:||:..|||.:||.|||.:..||||
  Rat   277 KMTRTDPTKPIRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCS 341

  Fly   268 RVGIIYKRDELEAQMAPNRNP-------SLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAES 325
            |||.::::          |:|       :|...:|.||..:||:||||.::|...|........|
  Rat   342 RVGHVFRK----------RHPYNFPEGNALTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGS 396

  Fly   326 LDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPH--FCLSIKG----- 383
            :....:.|::::||||.||...|.|::          ..|:.:::|.|...  .||..:|     
  Rat   397 VATRIEQRKKMDCKSFRWYLENVYPEL----------TVPVKEVLPGVIKQGVNCLESQGQNTAG 451

  Fly   384 ----GFPVIR-------KCHSTNFEDWTLTSRCQLKHGNMCLDVDYKNNVRATKCTKKLSKNPWH 437
                |..:.|       ...:..|.|..:..:.:.......|.....:.|....|..|..|..|.
  Rat   452 DLLLGMGICRGSAKSPPPAQAWLFSDHLIQQQGKCLAATSTLMSSPGSPVVLQSCNPKEGKQKWR 516

  Fly   438 YNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRW 476
               :..||:.:....|.::.....|:.:.|.:|...|:|
  Rat   517 ---RKGSFIQHSVSGLCLETKPAQLVTNKCQADAQAQQW 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 103/298 (35%)
pp-GalNAc-T 54..349 CDD:133004 109/309 (35%)
RICIN 367..478 CDD:238092 23/129 (18%)
Ricin_B_lectin 373..476 CDD:279046 21/121 (17%)
Galnt16NP_001094333.1 pp-GalNAc-T 126..420 CDD:133004 109/309 (35%)
WcaA 126..>222 CDD:223539 38/101 (38%)
Ricin_B_lectin 441..543 CDD:279046 17/105 (16%)
RICIN 441..543 CDD:238092 17/105 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94118535
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.