DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galntl6

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001129228.1 Gene:Galntl6 RGDID:1564773 Length:601 Species:Rattus norvegicus

Alignment Length:530 Identity:166/531 (31%)
Similarity:263/531 (50%) Gaps:56/531 (11%)


  Fly     1 MTETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPH 65
            :||.|..|:..:..  .:|.::|..|.|:|:|.|.|...| |.....|:....||:|....|...
  Rat    93 LTEEDHDDSAYREN--GFNIFVSNNIALERSLPDIRHANC-KHKMYLERLPNTSIIIPFHNEGWT 154

  Fly    66 TLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKL-------PIVIQLEMESSKGIIHA 123
            :|||.|:|:|.:|...|:.||:|| |...|.:   |:..||       |||..:..:..:|:|..
  Rat   155 SLLRTIHSIINRTPESLIAEIILV-DDFSDRE---HLKDKLEDYMARFPIVRIVRTKKREGLIRT 215

  Fly   124 RLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYR-KLVEPEQ 187
            ||.||.||.|::|.||:.|.||...||||||..|.||::|:..|::|.|....|.|. :..:..:
  Rat   216 RLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHSHFGYEAQAGDAMR 280

  Fly   188 LAFDWQLDHIFLPLDQHSWNSLP-KPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELS 251
            .||||::.:..:|:......:.| :|:.|..:.|.:||:||||||.|||:|.||..:||:..|:|
  Rat   281 GAFDWEMYYKRIPIPPELQRADPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEIS 345

  Fly   252 LKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPS-LQVQKNFKRVVDVWLDEYKLHFYRYN 315
            .|||.|||.:..|||||||.||::      ..|.:.|| ..:.:|.|||.:.|:||:..:.|:..
  Rat   346 FKVWMCGGEMFDVPCSRVGHIYRK------YVPYKVPSGTSLARNLKRVAETWMDEFAEYIYQRR 404

  Fly   316 PKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPF-------V 373
            |:.|:|:...:...::||:||.||.|:|:.:.||..:..:        ||..:.:|.       |
  Rat   405 PEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKY--------YPPVEPLPAAWGEIRNV 461

  Fly   374 APHFCLSIKGG-------FPVIRKCHS----TNFEDWTLTSRCQLKHG------NMCLD-VDYKN 420
            |.:.|:..|.|       ..:..|..|    ::.:.:|...|..::.|      ..||| :.:.:
  Rat   462 AANLCVDSKHGAMGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISHSS 526

  Fly   421 NVRATKCTKKLSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRWMFTKVQDFK 485
            .|....|........|.|....:.|....|.|:..:..:..:.::.||.....|:|||..:....
  Rat   527 PVTLYDCHGMKGNQLWGYREDRTLFHPVSNSCMDCNPAEKKVFMARCDPLSETQQWMFEHINMTV 591

  Fly   486 LDHMRDICLS 495
            |:.:....:|
  Rat   592 LEKISHYAIS 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 113/294 (38%)
pp-GalNAc-T 54..349 CDD:133004 119/305 (39%)
RICIN 367..478 CDD:238092 26/136 (19%)
Ricin_B_lectin 373..476 CDD:279046 23/121 (19%)
Galntl6NP_001129228.1 Glyco_tranf_2_3 140..365 CDD:290369 94/229 (41%)
pp-GalNAc-T 143..438 CDD:133004 119/305 (39%)
Ricin_B_lectin 454..582 CDD:279046 23/128 (18%)
RICIN 456..584 CDD:238092 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11675
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.