DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Pgant2

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_608773.2 Gene:Pgant2 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster

Alignment Length:530 Identity:155/531 (29%)
Similarity:242/531 (46%) Gaps:118/531 (22%)


  Fly     8 DAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIY 72
            |..::|   ::|...|:.:|..|.:.|.|:|.|....|..:...| |::|....|...||||.|.
  Fly   163 DPYIRN---RFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPET-SVIITFHNEARSTLLRTIV 223

  Fly    73 SVITQTSPYLLKEIVLVHD--GHPD--LDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATG 133
            ||:.::..:|::|||||.|  .||:  |:|.     |:..|..:..:..:|::.:|:.||..|..
  Fly   224 SVLNRSPEHLIREIVLVDDYSDHPEDGLELA-----KIDKVRVIRNDKREGLVRSRVKGADAAVS 283

  Fly   134 DILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIF 198
            .:|.||:.|:|....||.||||.:..:...|..|::|.||.::|.|.......:..|||.|  ||
  Fly   284 SVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNL--IF 346

  Fly   199 LPLDQHSWNSLPKPYPSSQ---------------LEGRVFAIDRKWFWHLGGWDEGLRDYGGDAL 248
                  .|..|.   ||.:               :.|.:|.||:.:|..||.:|..:..:||:.|
  Fly   347 ------KWEYLS---PSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENL 402

  Fly   249 ELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP------SLQV-QKNFKRVVDVWLDE 306
            |:|.:||||||.:..:||||||.::::          |:|      |..| .:|.:|..:||:|:
  Fly   403 EISFRVWQCGGSLEIIPCSRVGHVFRK----------RHPYTFPGGSGNVFARNTRRAAEVWMDD 457

  Fly   307 YKLHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMP 371
            ||.|:|...|..:|:...::|....|:.:|:||.|:||...|.|.::                  
  Fly   458 YKQHYYNAVPLAKNIPFGNIDDRLALKEKLHCKPFKWYLENVYPDLQ------------------ 504

  Fly   372 FVAP------HF------CLSIKG----GFPVIRKCHST-NFEDWTLTSRCQLKHGNMCLDVDYK 419
              ||      .|      ||...|    |...|..||:| ..::|..|.|.::||.::||.:  .
  Fly   505 --APDPQEVGQFRQDSTECLDTMGHLIDGTVGIFPCHNTGGNQEWAFTKRGEIKHDDLCLTL--V 565

  Fly   420 NNVRATKCTKKL---SKNP-W---------HYNYQHSSFVSNGNKCLQI-DVNKVGLILSACDSD 470
            ...|.::...|.   |:|. |         ||..         |.||.. |.::.|:....|:|.
  Fly   566 TFARGSQVVLKACDDSENQRWIMREGGLVRHYKI---------NVCLDSRDQSQQGVSAQHCNSA 621

  Fly   471 VTEQRWMFTK 480
            :..|||.|.|
  Fly   622 LGTQRWSFGK 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 99/310 (32%)
pp-GalNAc-T 54..349 CDD:133004 105/321 (33%)
RICIN 367..478 CDD:238092 35/142 (25%)
Ricin_B_lectin 373..476 CDD:279046 34/134 (25%)
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 83/259 (32%)
pp-GalNAc-T 205..500 CDD:133004 105/321 (33%)
Ricin_B_lectin 511..627 CDD:279046 32/127 (25%)
RICIN 513..629 CDD:238092 33/127 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94049896
eggNOG 1 0.900 E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11675
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.